KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1532Help
Entry
ZMO1532           CDS       T00221                                 

Definition
phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ZMO1532
Enzymes [BR:zmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     ZMO1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562316..1562981
Genome map
AA seq 221 aa AA seqDB search
MKAAVLVFPGSNCDRDLAVAIEKICGTKPLMVWHQESELPDDLDLIAVPGGFSYGDYLRS
GAMAARSAVMPAVIKQAERGVPVLGICNGFQILTEAGLLPGALMRNAGLSFICRNVGLEI
QNTTSPFLRLYKKNQKIHLPVAHHDGNYTADEATLDQLEDEDRVALRYTESVNGSARNIA
GVLNKKGNVLGLMPHPERMIEDAHGGKDGYNMFASLMQVMA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtccttgtctttccggggtcgaactgcgatcgcgatctggctgttgct
attgaaaaaatctgtggcaccaagcctcttatggtctggcatcaggaaagcgaattgccg
gatgacctcgaccttatcgctgtaccgggtggcttttcctatggggattatctgcgctct
ggtgccatggctgcccgttcagcggtcatgcctgcggtaattaaacaggctgaacgcggt
gtgccggttctcggtatttgtaacggtttccagatcttgaccgaagcgggtttgttgcct
ggtgctttgatgcggaatgctggtctgtcctttatttgccggaatgtcgggctggaaatt
cagaacacgacgtcgccattcctgcgtctttacaagaaaaaccagaaaatccatctgccg
gttgcccatcatgatgggaattataccgcggatgaggcgactttggatcagctggaagac
gaagatcgggtggcgttgcgctataccgaaagcgtcaatggttctgcccgcaatattgct
ggtgttcttaataagaaaggcaatgttcttggcttgatgccgcatcctgaaagaatgatc
gaagatgcccatgggggcaaagatggctataacatgtttgcatctttgatgcaggttatg
gcttaa

DBGET integrated database retrieval system