KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1647Help
Entry
ZMO1647           CDS       T00221                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZMO1647
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ZMO1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1692508..1693059)
Genome map
AA seq 183 aa AA seqDB search
MLYAIALGSNRWHGRYGRPSAVIEAAIAALEKEKIAIHSRAPIFETSAVGPGGRRYANSA
IIIKTDLQPLALLALCKKVEQAFGRRKGQRWGARVLDLDIVLWEKGRWPRKIQPRLRYKP
ALAAGQPPALWPKLHIPHLEISRRDFVLKPLLSIAGNWPVFQKNGFFTVKQLYFRYKYLT
SKQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgctttacgctatcgcactaggctctaatcgttggcatggtcggtatggtcggccatct
gcggtcatcgaggcggcgattgctgcattggaaaaagaaaagattgcgatccattctcgc
gctccgatttttgaaacctcagctgtcgggcccggtggacggcgttatgccaattccgcg
attattattaaaacagatttacagccgcttgcattgctggcgctttgtaaaaaagtagaa
caggctttcggcagaagaaaagggcaaagatggggggcgagggtgctcgatcttgatatt
gtcttatgggaaaaaggccgctggccacgaaaaatacaaccccgccttcgctacaagcct
gccttggctgcaggacaaccaccggctttatggccaaaacttcatattccccatcttgag
atcagtcgtcgtgattttgtgctgaaacctctgctttcgatcgccggaaattggcctgtt
tttcaaaaaaatggattttttacggtaaaacagctatattttcgctataagtacttgacc
tccaagcaataa

DBGET integrated database retrieval system