KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1879Help
Entry
ZMO1879           CDS       T00221                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZMO1879
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ZMO1879
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZMO1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1930256..1931257
Genome map
AA seq 333 aa AA seqDB search
MSLVPTQYPATRLRRLRASAWSRSMHSENVLTPADFIWPLFVTGGKGVKEAVQSMPGVFR
WSVDLIVEQAKLAHSLGIPCLALFPNTDIAKRSEDGREAWNADNLMCQAIRAIKDAVPDI
GLLTDVALDPYTSHGHDGVIDAQGYVLNDETKELLIKQARVQAEAGADIIAPSDMMDGRV
AAIRDMLESEGHRNVQIMSYAAKYASVFYNPFRDAVGSAGIFKADKKTYQMDPANSDEAL
REVAMDIAEGADSVMVKPGLPYLDVLYRVKESFKLPVFAYQVSGEYAMLEAAFAAGMLDK
DKAVLETLTCFKRAGAAGVLTYHAVHAAKLLNG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagtccctacacaatatccggcaacgcgcctgcgtcgcctccgtgcttccgct
tggagccggagcatgcattccgaaaatgtcttgacccctgccgactttatctggccgtta
tttgtgacgggtgggaaaggcgtgaaagaggccgttcagtccatgcccggcgttttccgc
tggtctgttgatctgattgttgaacaagccaaattagcgcacagcctcggcatcccttgt
ctggccttattcccgaataccgatatcgccaaacgcagcgaggatgggcgggaagcatgg
aatgctgataatctgatgtgtcaggctattcgtgccatcaaagacgcggttcccgatatc
ggcttgttaaccgatgtcgccttggatccttataccagccatggtcacgacggcgttatt
gatgcgcagggctatgttctgaatgacgaaaccaaagaattactgattaaacaggctcgg
gttcaggccgaagccggtgccgacattattgccccttccgatatgatggatggacgggtt
gccgctatccgcgacatgctggaaagcgaaggccatcgcaatgtccagatcatgtcctat
gccgctaaatatgcgagcgttttttataatcccttccgtgatgcggtcggttcggctggt
attttcaaagccgacaagaaaacctaccaaatggatccggccaatagtgatgaagccttg
cgcgaagtcgctatggatatcgcagaaggcgcagacagcgtcatggtcaaacccggcctt
ccttatctcgatgtgttatatcgcgtaaaagaaagctttaaattgccggtctttgcctat
caggtctctggtgaatatgcgatgttagaagccgcctttgcagccggtatgctcgacaaa
gataaggccgttctagaaaccctaacctgcttcaaacgcgccggagccgcaggtgtttta
acctatcatgcggttcatgcggcaaagcttttgaatggctaa

DBGET integrated database retrieval system