KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1891Help
Entry
ZMO1891           CDS       T00221                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zmo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:zmo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:zmo00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1941245..1942642)
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPENWPAFSREDIAALAGLSYVDTAVAVMR
PFVSGVLDDQALKNLCEAAYGQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLSEEKGQDLTIVGATSGDTGSAAISAVAGRAGVQIVMLHPNGRVSEVQRRQMTT
VLDKNVHNVAIDGSFDDAQAIVKAMFNDSDFRKRHRLGAVNSINWARLMAQIVYYFYAAV
RLGAPDRKVAFSVPTGNFGDVFAGYAAKKMGLPVEKLIVATNINDILYRALSAGDYSVGN
VTPTDAPSMDIQISSNFERLLFDLHGRDAASLAATMAQFEQSRAIQISDAMRQQAATIFS
SKRIDPDEMAATMRWASDKAGQVIDPHTAIGLAAARETDLPKDVPVVTLATAHPAKFPDA
VSRITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDAGFQL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaaggggcgcggcagccgcgcaggattttaagggcgttacctta
accgggcttgcctcggatggtggtctctatgtgccagaaaattggccagccttcagccgc
gaggatatcgctgcattagcaggattgtcctatgtcgatacggctgttgcggttatgcgg
ccatttgtcagcggtgtgctcgacgatcaggcattaaaaaatctgtgcgaagccgcttat
ggtcagttcaaccatgcagctgttacgccgttggttcagttagatgaacggcatttcttg
ctggaattatttcatggcccgaccttggctttcaaggatgttgctttacaacttctcggt
catttatttgaaaaattcctttccgaagaaaaaggacaggatctgacaatcgtcggagca
acctccggtgatactggatcagcggctatatctgctgttgctggacgagctggcgtgcaa
attgtgatgttgcatcccaacggtcgggtttccgaagttcaacgtcgccaaatgacgacg
gttctcgacaaaaatgtccataatgtcgcgattgacggtagctttgatgatgcacaggct
attgttaaagccatgttcaacgatagcgactttagaaaacgtcatcgtctgggcgctgtt
aattcgattaactgggcacgcttgatggctcagatcgtttattatttctatgcggctgtt
cgtcttggtgcacctgatcggaaagtagctttttctgttcctaccggtaactttggtgat
gtttttgcgggttatgctgccaaaaaaatggggcttcctgtcgaaaaattgatcgttgcg
actaacatcaatgatatcctttatcgggcattgtcagccggcgattattctgtcggtaat
gtaaccccgaccgatgcgccgtcgatggatatccaaatcagttccaattttgaacgcctg
ctttttgaccttcatggtcgggatgcggcttctttggcagcaacaatggcgcaatttgaa
cagagtcgtgctatccagatttctgatgcaatgcgccagcaagctgcaacgatattcagc
agcaaacgcattgatcccgatgaaatggctgcaaccatgcgttgggcttccgataaagca
ggacaggttattgatcctcatacggctattggtttggcggccgcccgtgaaacagatctt
ccaaaggatgttccggtcgttaccttggcaactgcccatccggcaaaattccctgatgct
gtttcccgtattacgggtaaaaatgctcctctgccgcatcgtttggctgatctttacagc
cgtgaagaacgctatgttgaactgcctgcgtcacgtcagacaattcaggcttatattgat
gccggattccagctttga

DBGET integrated database retrieval system