KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1891Help
Entry
ZMO1891           CDS       T00221                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00260  Glycine, serine and threonine metabolism
zmo00750  Vitamin B6 metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01230  Biosynthesis of amino acids
Module
zmo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO1891
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ZMO1891
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ZMO1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Caud_tail_N
Motif
Other DBs
NCBI-ProteinID: AAV90515
UniProt: Q5NL95
Position
complement(1941245..1942642)
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPENWPAFSREDIAALAGLSYVDTAVAVMR
PFVSGVLDDQALKNLCEAAYGQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLSEEKGQDLTIVGATSGDTGSAAISAVAGRAGVQIVMLHPNGRVSEVQRRQMTT
VLDKNVHNVAIDGSFDDAQAIVKAMFNDSDFRKRHRLGAVNSINWARLMAQIVYYFYAAV
RLGAPDRKVAFSVPTGNFGDVFAGYAAKKMGLPVEKLIVATNINDILYRALSAGDYSVGN
VTPTDAPSMDIQISSNFERLLFDLHGRDAASLAATMAQFEQSRAIQISDAMRQQAATIFS
SKRIDPDEMAATMRWASDKAGQVIDPHTAIGLAAARETDLPKDVPVVTLATAHPAKFPDA
VSRITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDAGFQL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaaggggcgcggcagccgcgcaggattttaagggcgttacctta
accgggcttgcctcggatggtggtctctatgtgccagaaaattggccagccttcagccgc
gaggatatcgctgcattagcaggattgtcctatgtcgatacggctgttgcggttatgcgg
ccatttgtcagcggtgtgctcgacgatcaggcattaaaaaatctgtgcgaagccgcttat
ggtcagttcaaccatgcagctgttacgccgttggttcagttagatgaacggcatttcttg
ctggaattatttcatggcccgaccttggctttcaaggatgttgctttacaacttctcggt
catttatttgaaaaattcctttccgaagaaaaaggacaggatctgacaatcgtcggagca
acctccggtgatactggatcagcggctatatctgctgttgctggacgagctggcgtgcaa
attgtgatgttgcatcccaacggtcgggtttccgaagttcaacgtcgccaaatgacgacg
gttctcgacaaaaatgtccataatgtcgcgattgacggtagctttgatgatgcacaggct
attgttaaagccatgttcaacgatagcgactttagaaaacgtcatcgtctgggcgctgtt
aattcgattaactgggcacgcttgatggctcagatcgtttattatttctatgcggctgtt
cgtcttggtgcacctgatcggaaagtagctttttctgttcctaccggtaactttggtgat
gtttttgcgggttatgctgccaaaaaaatggggcttcctgtcgaaaaattgatcgttgcg
actaacatcaatgatatcctttatcgggcattgtcagccggcgattattctgtcggtaat
gtaaccccgaccgatgcgccgtcgatggatatccaaatcagttccaattttgaacgcctg
ctttttgaccttcatggtcgggatgcggcttctttggcagcaacaatggcgcaatttgaa
cagagtcgtgctatccagatttctgatgcaatgcgccagcaagctgcaacgatattcagc
agcaaacgcattgatcccgatgaaatggctgcaaccatgcgttgggcttccgataaagca
ggacaggttattgatcctcatacggctattggtttggcggccgcccgtgaaacagatctt
ccaaaggatgttccggtcgttaccttggcaactgcccatccggcaaaattccctgatgct
gtttcccgtattacgggtaaaaatgctcctctgccgcatcgtttggctgatctttacagc
cgtgaagaacgctatgttgaactgcctgcgtcacgtcagacaattcaggcttatattgat
gccggattccagctttga

DBGET integrated database retrieval system