KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1902Help
Entry
ZMO1902           CDS       T00221                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZMO1902
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ZMO1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1951973..1952701)
Genome map
AA seq 242 aa AA seqDB search
MLREWQLNNRVQDKLLILRPEPGATATAKRAEKVGWQVIKTPLATAISIPWSINESLSFD
AVMVTSAQAIYHGGSELDKLKDYPLYVVGKATEAAARQAGFQHIVTAEGNGASVLCCLER
DKRMRILRLCGEIYKDYEYKNFSRKENTQFFIKILYRMQNIASLPIEACQALVENAIVLL
HSSRFAEQFRLLLAKTDINPDRVQIAVISPAVAEQIGKEWRAMAIAEYPDDTSLLKAAAS
LK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgagagaatggcaattaaataatcgtgttcaagataaattattgattttacgcccc
gagccgggggcaaccgctacagccaagcgtgcagaaaaagtaggttggcaagtaataaaa
acgcctcttgcaacggctatatcgataccttggtcaataaatgaatctctatcttttgat
gcggttatggtaacgagtgcccaagctatttatcacggaggaagtgaactggataaatta
aaagactatcctctttacgtggttggcaaggctactgaggcggcggcacgtcaggcaggg
tttcagcatattgtaacggccgaaggtaatggcgcatctgtactttgttgtcttgaacgg
gacaaaagaatgcggatattaaggctctgcggcgaaatttacaaagattatgaatataaa
aatttttctcggaaagaaaacactcaattctttataaaaattctttatagaatgcaaaat
attgccagtttaccgatagaagcctgtcaggcattagtagaaaatgccatagtcttatta
cactcttctcgttttgcagagcaatttcgtcttttgcttgcgaaaacggatatcaatcca
gacagagttcagattgctgttattagcccagcagtagcagaacaaattggaaaagagtgg
cgagcaatggcaatagctgaatatcctgatgacacatctttgttaaaggcagcagctagc
ttgaaatga

DBGET integrated database retrieval system