KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0031Help
Entry
Zymop_0031        CDS       T01556                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Zymop_0031
   00240 Pyrimidine metabolism
    Zymop_0031
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Zymop_0031
   03430 Mismatch repair
    Zymop_0031
   03440 Homologous recombination
    Zymop_0031
Enzymes [BR:zmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Zymop_0031
DNA replication proteins [BR:zmp03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Zymop_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37860..38303
Genome map
AA seq 147 aa AA seqDB search
MVTRIDFYHLLSTTIDDVLPRIAEKALTADKNLLIVVKDDQQAKALDRHLWCYTPESFLP
HGCVGAGDEEAQPILISSLPDALNHAPYIALADGLWRQESLNFERVFYFFDESSIQIARK
AWRFLADTEGERHYWKQDSRGKWQKFA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
ttggtaacacgcattgatttttatcatttattatcaacaacaatagatgatgtgttaccg
cgtatcgcagaaaaagccctgacggctgataaaaacctgttgatcgttgtaaaagacgat
caacaggctaaggcgctcgaccgacatttgtggtgctatacgcctgaaagttttttgccc
catggatgcgtgggggcaggggatgaagaggcacagcccattttaatctcgtctcttcct
gatgccttgaaccatgccccttatattgccttggcagatgggctttggcgccaagaatct
ttgaattttgagcgggttttctatttttttgacgaatcctctatccagatagcacgaaag
gcttggcgttttctggccgatacagaaggggagcggcattattggaaacaggatagccgt
ggaaaatggcagaaattcgcgtga

DBGET integrated database retrieval system