KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0079Help
Entry
Zymop_0079        CDS       T01556                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Zymop_0079
Enzymes [BR:zmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Zymop_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
88086..88691
Genome map
AA seq 201 aa AA seqDB search
MKDKQDLATLHPDQNVPEEIQEAIRSLIRWVGDDPEREGLLDTPKRVAKAWKAYCRGYQE
NPVDHLGTVFEEVGGYDDLVLLKDIPFYSHCEHHMAPIIGHAHIAYLPDKRVVGISKLAR
VLKGYAQRLQIQERLTTEVADCIWNGLHPHGVAVVIAATHSCMSARGVETPGVLTVTKTM
RGVFKTDIERQKIVLGLMGVS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaacaagatctggcgaccttacatccagatcagaacgtaccggaagaaata
caggaggctattcgtagcctaatccggtgggtaggtgatgatccagaacgggaaggctta
ctggataccccaaaacgtgttgccaaggcatggaaagcttattgtcgcggctatcaagaa
aatccggtcgatcatttaggtaccgtatttgaagaagtcgggggttatgacgatctggtt
ttgttaaaagatattcctttttattcccattgcgaacatcatatggcgccgattatcggt
catgcccatatcgcctatcttcctgataaaagagtagtgggtatttctaaactggcccgt
gttctcaaaggatacgcccaacgtcttcaaattcaagagcgtctcacgaccgaagttgca
gactgcatctggaatggcctccatcctcatggcgtagcggttgttatcgccgctactcac
agttgtatgtctgcaagaggggtagaaacaccaggcgtcttgacggtaacgaagacaatg
cggggcgtgtttaaaacagatatagagcgtcaaaaaatagtattaggtctaatgggcgtc
tcttaa

DBGET integrated database retrieval system