KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0119Help
Entry
Zymop_0119        CDS       T01556                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:zmp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133793..134641
Genome map
AA seq 282 aa AA seqDB search
MPLLTEIAYAKINLALHVREKMPNGYHALETIFAFAADGDHLTAEPIDQSQDKLSIIGPF
AEGLEADKNNLVLRAVVALRTAYPDKIPSAFNIILDKRLPIAAGIGGGSADAAAILRMLG
KHYNIGHNDLLALAAKLGADVPACVDSHLIRGEGVGEKLTPIADSSLKNTPLLLVNPRVS
CSTPLIFEKWDGVDRGPLAEGNVLEAARSGRNDLEPPAEKLIPIIGEVIRKLKAQKGVRF
ARMSGSGATCFALFNTQKDCRKAALDLSSEHPEWWFMTSTLC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgcctctgctgacagaaatagcctatgccaaaatcaatctggccctccacgtcagagaa
aaaatgccgaatggttatcatgccctagagacaatttttgcttttgcggcggatggggat
catcttacagcagaaccgattgaccagtcgcaggataaattaagcatcataggccccttt
gctgaagggttagaagccgataaaaataatctggttttgcgtgctgtagtcgctttaaga
acggcttatcctgataagataccctctgcctttaatataattctggataaaagattgcca
atcgctgcgggtatcggcggcggttcagcagatgcggcagccattttgcggatgcttgga
aaacattataatattggacataacgaccttttagcactggctgctaaattaggtgccgat
gttccggcttgtgttgattctcaccttattcgtggagaaggcgttggagagaaattgacg
cctattgcggattcatccttgaaaaatacgcctctgttattggttaatccacgggtttct
tgttcgacgcccttaatttttgaaaaatgggatggtgttgatcgtggccctttggctgaa
gggaatgtattagaggcagcgcgatccggtcggaatgatctagaaccgcccgccgaaaaa
ttgataccaattatcggagaagtaatccgtaagttaaaagctcaaaaaggggttcgtttt
gcccgtatgtcgggatcaggcgctacctgctttgctttgtttaatacccaaaaagactgt
cgtaaagctgctttggatctatctagcgaacatcctgaatggtggtttatgacgtcaaca
ttatgttga

DBGET integrated database retrieval system