KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0130Help
Entry
Zymop_0130        CDS       T01556                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Zymop_0130
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Zymop_0130
Enzymes [BR:zmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Zymop_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149396..150427
Genome map
AA seq 343 aa AA seqDB search
MKPVFIGIEGPHLTPQEKILFKEVNPAGYILFQRNITNRIQLRNLTDMLHDISGWNIPIL
IDQEGGRVARMRPPIWPSFPAAGCFDALYQKAPMTAIEAVRANTTALAYLLQDVGINVDC
MPLLDIRDPKGHNIIGDRSFSDNPEQVAALGQAALDGLATGGICGVIKHIPGHGQAQVDS
HKMLPIVEATLTILERDIIPFQRLKSAKMAMTAHVIYTEWDKRNCATYSPFVICKIIRQK
IGFEGLLMSDDIGMEALEGDAVTRATRVLKAGCDVVLHCSGQYEEMHNILYAIDDISSEA
SNRLQQATASFKPIDFNFDKPEDKAHFDGLIAKRDALLRVGSI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggtttttatcggcatagaaggccctcatctgacgccacaggaaaaaattctt
tttaaagaagttaatcccgctggttatatcctgtttcaacgcaatattacaaatcgcatc
caattgcgcaatttgactgatatgttacatgatatatccggatggaatatccctatttta
attgatcaggagggcggacgagttgcacgaatgcgtccacctatttggccctcttttccg
gcagcgggttgttttgatgcactttaccaaaaggcacccatgacggctattgaagccgta
agagccaacacaacagcgttagcctatctcttacaagatgtcggtattaatgtcgattgt
atgcctttattagatattcgtgaccccaaaggacataatatcatcggtgatcgttctttt
agtgataatcctgaacaagtagcagctttaggacaggctgctttagacggtctggcaaca
ggaggtatctgtggcgttatcaagcacattcctggtcatggacaagcccaagtcgatagt
cataaaatgttgcctattgttgaggcaactctgactatcttagaacgggatattatccct
tttcaacgtctaaaatcagcaaaaatggcaatgaccgctcatgttatctatacagaatgg
gacaaaagaaactgtgctacttattcaccttttgtaatctgtaaaatcatccgtcaaaag
atcggatttgaagggctgttaatgtcggatgacatcggcatggaagctttagagggggat
gcggtcacccgcgcaacacgcgttttaaaagcaggttgcgatgtcgttctacattgctct
gggcagtatgaagaaatgcataatattctttacgcaattgatgacatttcttccgaagct
tctaatcggttacaacaagctacagctagttttaaacctatagactttaactttgataag
cctgaggataaagcgcattttgacggtttgattgcgaaacgggatgccttacttagagta
ggctcaatataa

DBGET integrated database retrieval system