KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0130Help
Entry
Zymop_0130        CDS       T01556                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:zmp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:zmp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149396..150427
Genome map
AA seq 343 aa AA seqDB search
MKPVFIGIEGPHLTPQEKILFKEVNPAGYILFQRNITNRIQLRNLTDMLHDISGWNIPIL
IDQEGGRVARMRPPIWPSFPAAGCFDALYQKAPMTAIEAVRANTTALAYLLQDVGINVDC
MPLLDIRDPKGHNIIGDRSFSDNPEQVAALGQAALDGLATGGICGVIKHIPGHGQAQVDS
HKMLPIVEATLTILERDIIPFQRLKSAKMAMTAHVIYTEWDKRNCATYSPFVICKIIRQK
IGFEGLLMSDDIGMEALEGDAVTRATRVLKAGCDVVLHCSGQYEEMHNILYAIDDISSEA
SNRLQQATASFKPIDFNFDKPEDKAHFDGLIAKRDALLRVGSI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggtttttatcggcatagaaggccctcatctgacgccacaggaaaaaattctt
tttaaagaagttaatcccgctggttatatcctgtttcaacgcaatattacaaatcgcatc
caattgcgcaatttgactgatatgttacatgatatatccggatggaatatccctatttta
attgatcaggagggcggacgagttgcacgaatgcgtccacctatttggccctcttttccg
gcagcgggttgttttgatgcactttaccaaaaggcacccatgacggctattgaagccgta
agagccaacacaacagcgttagcctatctcttacaagatgtcggtattaatgtcgattgt
atgcctttattagatattcgtgaccccaaaggacataatatcatcggtgatcgttctttt
agtgataatcctgaacaagtagcagctttaggacaggctgctttagacggtctggcaaca
ggaggtatctgtggcgttatcaagcacattcctggtcatggacaagcccaagtcgatagt
cataaaatgttgcctattgttgaggcaactctgactatcttagaacgggatattatccct
tttcaacgtctaaaatcagcaaaaatggcaatgaccgctcatgttatctatacagaatgg
gacaaaagaaactgtgctacttattcaccttttgtaatctgtaaaatcatccgtcaaaag
atcggatttgaagggctgttaatgtcggatgacatcggcatggaagctttagagggggat
gcggtcacccgcgcaacacgcgttttaaaagcaggttgcgatgtcgttctacattgctct
gggcagtatgaagaaatgcataatattctttacgcaattgatgacatttcttccgaagct
tctaatcggttacaacaagctacagctagttttaaacctatagactttaactttgataag
cctgaggataaagcgcattttgacggtttgattgcgaaacgggatgccttacttagagta
ggctcaatataa

DBGET integrated database retrieval system