KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0147Help
Entry
Zymop_0147        CDS       T01556                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Zymop_0147
Enzymes [BR:zmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Zymop_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166243..167409
Genome map
AA seq 388 aa AA seqDB search
MNQPRTVTVLGATGSIGHSTLDLIERNPDRYQVMALTAHRNVKELAAAAKRTKAKRAVIA
DESLYSALKEALAGTDVEAAAGPTALVEAAAMGADWTMAAIIGCAGLKPTLAAIRAGKTV
ALANKEALVSAGALMIEAVKNHGTILLPVDSEHNAIFQCFPHNNPEYVRRIIITASGGPF
RKTPLEDMAKVTPEQAVRHPNWSMGAKISVDSATMMNKGLELIEAYHLFKVPLDTFEILV
HPQSVIHSMVEYRDGSILAQIGSPDMRTPIGHTLAWPKRMETPSESLDFAKLRQMDFEAP
DYQRFPALSLAVHSLKAGGPRPAVMNAANEIAVAAFLERKIGFLDIAKIVEKTLEYYTPP
APSSLEDVFAIDSEARLQAMNLMESLPA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcccagaacggtaaccgtgttaggtgcgaccggttcaatcggccattcaact
ttggatttgattgaacggaatcctgaccgttatcaggtgatggccttgactgctcaccgt
aatgtaaaagaactagccgcagccgctaagcggacgaaagcaaaacgagccgttattgcg
gatgaaagcttatattctgctttaaaagaagccttggcgggcactgatgtcgaagctgct
gctggccccacggccttagttgaagccgctgccatgggggcagattggactatggcggct
attattggatgtgcgggcttaaaaccaacgctggccgctattcgtgcgggtaaaacggtt
gcacttgctaacaaagaagccttagtctcagcgggtgcgttgatgattgaagcggttaaa
aatcatggcactattcttttacctgtagattctgagcataatgctatttttcagtgtttc
cctcataataatcctgaatatgttcgacggattattatcacggcaagcggaggtcctttc
cgtaaaacccctttagaggatatggctaaggtaacacctgaacaagcggttcgacatccc
aattggtctatgggtgctaaaatctctgttgattcggctacgatgatgaataaaggactc
gagctgatcgaagcctatcatttatttaaggtccccttagataccttcgaaattttagtt
caccctcaatcggttattcattctatggtggaatatcgggatggctctattttagcgcaa
atcggtagtccagatatgagaacgcctattgggcacaccttagcttggcccaaacgcatg
gaaaccccttccgaatctttggattttgctaaattacggcaaatggattttgaagcgccc
gactatcagcgttttccggcgctctctttagccgttcattctttgaaagcgggcgggccg
cgtccagctgttatgaatgcagctaatgaaatagctgttgctgcctttcttgagcgcaaa
atcggctttcttgatattgctaaaattgttgaaaaaacgcttgagtattatacgccaccg
gcaccttcttccttagaagatgtctttgccattgatagtgaagcgcgcttacaggctatg
aatttaatggagagtttacccgcgtga

DBGET integrated database retrieval system