KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0160Help
Entry
Zymop_0160        CDS       T01556                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Brite
Enzymes [BR:zmp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Zymop_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181108..182565
Genome map
AA seq 485 aa AA seqDB search
MNIKALLGSAVVLAIVAYGATTSYLVHYDHKTAPKLSDSSPTHNDPKAKAAFATIAEARC
DYCHSKEAKLPFYASLPVAKQLMQHDIEEGLRHFQIQPVLTALEKGEPVDEESLARIQYV
VEHNMMPPNLYLFMHWHAALGKNGKKAMLEWIGATRIKNYDTAGVARQFLDAPIQPIPAA
DFSNKAKIALGEQLFFDKQLSGDGTLNCASCHGLNKGGVDNLVTATGIGGQKGPINVPTV
YNSVYNKLQFWDGRAKDLPDQAAGPIMNPVEMGSHSWTEVSQRVADQPGYKAAFTQVYGN
STIDKERITDAIGAYEATLVTPDSRFDQYLKGNDHAITAQEKRGYALFQDLGCASCHVGK
EMGGQSFEIMGLEGDYFGKRGHPTDADLGRFSQTHNDLDRHRFNVPTLRNIALTAPYFHD
GSAKTLEDAVKVMVRYQTRKGSIPEQDINDIVAFLKAQTGTYRGHNLATITEAEADPQTM
SIGGK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaggctttactgggatctgctgtcgttttagcgatagtagcctatggggca
accacctcttatcttgtccattatgatcacaagacagcgcctaaactttctgattcttcg
cctacccataatgatccaaaagctaaggccgcctttgccactattgcagaagcgcgctgc
gattactgtcatagcaaagaggctaaattacctttttatgccagccttcctgtcgcaaaa
cagttaatgcagcatgatatagaggagggactgcgccattttcaaattcagcctgttttg
actgcattggaaaagggcgaacctgtagatgaagaatctcttgcgcgtattcaatacgtg
gtcgagcataatatgatgccgcctaatctgtatctctttatgcattggcatgccgcgtta
ggcaaaaatggcaaaaaagcaatgcttgaatggattggggcaacccggattaaaaattac
gatacggcaggtgtcgctcgtcaatttttagatgcgcctatccaacctattcccgccgca
gatttttctaataaagcaaaaattgcccttggtgagcagctgttttttgataagcagctc
tctggtgatggcaccctgaattgcgctagttgtcatggccttaacaagggcggtgtagat
aatttagtaacggcgacagggatcggcggccaaaaagggccaattaatgtccctaccgta
tataattcagtatataacaaattacagttttgggacggacgagctaaagatctgccagat
caggcggcaggcccaattatgaatcctgttgagatgggctcccatagctggacagaagta
agccagcgtgtagcggatcaaccgggctataaagcggctttcactcaggtatatggtaat
agtaccatcgataaagaacgtattaccgatgctattggcgcttatgaggcaacattggta
acgcccgatagccgctttgatcaatatttgaaagggaacgatcacgctattacagcacag
gaaaagcgtggttatgctttatttcaagatttaggctgtgcgtcttgccatgtaggcaaa
gagatgggtgggcaaagctttgaaatcatggggctagaaggcgattatttcgggaaacga
ggacatccgacggatgctgatcttggccgtttctcccagacccacaatgatcttgaccgg
catcgttttaatgttccaaccctacgcaatattgcgctaacggcaccctatttccatgat
ggtagcgcaaaaacattggaagatgcggtgaaagttatggtacgctatcagacgcgtaaa
ggcagtattccagaacaggacatcaatgatatagtagctttcttgaaagcccagaccggc
acctatcgtggtcacaatttagcaactattacggaagcagaagctgatcctcaaacaatg
tcgattggtggaaaataa

DBGET integrated database retrieval system