KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0203Help
Entry
Zymop_0203        CDS       T01556                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Zymop_0203
Enzymes [BR:zmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Zymop_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(236394..237431)
Genome map
AA seq 345 aa AA seqDB search
MKQSSVMIYNRRFILASLMTIPLITACSKAHATDQSNWKLFCNRFLKEGRIVDSGNGGIS
HSEGQGYGLLQAEAAHDRANFDALWQWTKTHLMRSDMALFAWRYDGSQQNPISDLNNATD
GDILIAWALLRAESRWPGKGYGAASAAIRQAIGKKLVLSGGGETILLPGLQGFVGTDHVT
LNFSYYIWPALKAFDQVDNGMWRTVIESGKKLLSRARFGLPQLPTDWVDFKNDGSLAPAA
DKQPYFGFDAIRIPLYLIWGGEDALAVPFAVYWNSYLTHNQPIPAWIDLNTQAIAPYPLS
TGGMAIVHLMLNKPITSKITEQDDYYSAALLALAEIAHEERPHLR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaatcttcagttatgatatataaccgccgttttatacttgccagcttaatgact
attccgttgataacagcttgtagtaaggctcatgcaacagatcaaagtaattggaagtta
ttttgcaatcggttcttaaaagaaggccgtattgtcgatagcggtaacggtggtattagt
catagtgaagggcagggatatggcctgctacaagctgaagcggcccatgatcgcgctaac
ttcgatgctctatggcaatggacaaaaacgcatttaatgcgttcagatatggcactgttt
gcatggcgctatgatggatcacagcaaaatccgatctctgatcttaacaatgctactgac
ggtgatattctgattgcatgggccctgttacgggcagaatcccgctggccgggtaagggg
tatggtgcggcatccgccgctatcaggcaggctattggtaaaaaattagttctttcgggt
gggggcgaaactattcttttacccggattacagggttttgtcggcacagatcatgtgacg
ttgaatttttcttattatatttggccagccttaaaagcgttcgatcaggtagataacggt
atgtggcgtacggttattgaaagtggcaaaaaattgctatcccgtgctcgttttggatta
cctcaattaccgacagactgggttgattttaaaaatgatggcagtttagcgcctgccgct
gataaacagccctattttggttttgatgccatccgtatcccgctttacttaatttggggt
ggagaagacgcgttagcagtgccttttgctgtctattggaatagttatctcacccataac
caaccaataccggcatggattgatcttaatacgcaggcgattgcgccttatccgctttca
acaggcggtatggctattgttcatttgatgctgaataaaccgattacctcgaaaataacc
gaacaagatgattattattctgctgctctgttagcgcttgctgaaatagcccatgaagaa
aggcctcatttgcgttaa

DBGET integrated database retrieval system