KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0378Help
Entry
Zymop_0378        CDS       T01556                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00010  Glycolysis / Gluconeogenesis
zmp00052  Galactose metabolism
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01120  Microbial metabolism in diverse environments
zmp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zymop_0378
   00052 Galactose metabolism
    Zymop_0378
Enzymes [BR:zmp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Zymop_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEI37281
UniProt: F8EUZ3
Position
438877..440052
Genome map
AA seq 391 aa AA seqDB search
MRIFSKHVLGLCFGLTLSVITFTSSAHSAPTNVSFSQAPFGKTAEGEAVSIYTLKNTKGV
IVRFISYGGIIQSIETPDRDGKSGDIVLGFADLKGYTVDAAKGGLFFGALIGRYANRIAK
GTYTLQGKTYNVPITATPNALHGGTRGFDKYVWTVRPLPATEHEAGAVLTLVSPDNDQGF
PGTLTVHVTYTLNDQNELRLRYQATTDKPTVLNLSNHSYFNLGGEGSGSIEDEILKINAD
NYTPTDMTSIPTGDIVSVAGTPLDFRNPMRVGDHLRDNYPQLQYARGYDQNWVINGAYGK
QPRLAAQIFDPKTGRAMDVLTSQPGLQVYTSNSLDGTYYGKTGKQYRQTDAIAFEAEHYP
DSPNHPSFPTTELKPGQNFDYTTVFRFGVRR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttttctaagcatgtattaggcttatgctttggcttaactttgtctgtaata
acctttacatcctctgcccatagtgcccctacaaatgttagtttcagtcaagcgcctttc
ggaaaaacggctgaaggagaagcggtatcaatttatactttgaaaaatactaagggcgta
atcgttcggtttatttcctatgggggtattattcagtccatagaaacgcctgatcgtgat
ggtaaatcaggcgatattgtactcggttttgcagatttaaaaggctatactgtagatgcc
gcaaaaggcggtttattttttggggccctaattggtcgttatgcgaaccgcattgccaag
ggaacttatacacttcaaggtaagacttataatgtccctattaccgcgacccccaatgct
ttacacggtggtacgcgcggttttgataaatatgtgtggactgtgcgccctttacccgca
actgaacatgaagcgggtgctgtactaacgctagttagccctgacaatgatcaaggtttt
ccaggcacattaacggtacatgtaacctatacgcttaatgatcagaatgaattacggtta
cggtatcaagctacaacagataaaccgaccgttcttaatctcagcaatcatagttatttt
aatttagggggtgaaggatccggctcaatcgaagatgaaatcttaaaaattaatgccgat
aactatacacctactgatatgacttcaattccaacgggcgatattgtcagtgttgcaggg
acacctttggattttcgtaaccctatgcgtgtcggggatcatctacgcgataattatccc
cagcttcaatatgcacggggatatgaccaaaattgggttataaatggtgcttatggaaaa
cagcctcggttggcagcgcaaattttcgatcctaaaacggggcgtgcaatggatgtgctg
acatcacaacctggcttacaggtctatacctccaactcactggatggcacatattacggg
aaaacaggtaaacaatatcgtcagacagatgcaatagcctttgaagccgaacattatcca
gattcccctaatcatccttcttttcctacaaccgagcttaaacccggacagaattttgat
tatacgaccgttttccgtttcggtgttcgtcgttaa

DBGET integrated database retrieval system