KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0378Help
Entry
Zymop_0378        CDS       T01556                                 

Definition
Aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zymop_0378
   00052 Galactose metabolism
    Zymop_0378
Enzymes [BR:zmp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Zymop_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438877..440052
Genome map
AA seq 391 aa AA seqDB search
MRIFSKHVLGLCFGLTLSVITFTSSAHSAPTNVSFSQAPFGKTAEGEAVSIYTLKNTKGV
IVRFISYGGIIQSIETPDRDGKSGDIVLGFADLKGYTVDAAKGGLFFGALIGRYANRIAK
GTYTLQGKTYNVPITATPNALHGGTRGFDKYVWTVRPLPATEHEAGAVLTLVSPDNDQGF
PGTLTVHVTYTLNDQNELRLRYQATTDKPTVLNLSNHSYFNLGGEGSGSIEDEILKINAD
NYTPTDMTSIPTGDIVSVAGTPLDFRNPMRVGDHLRDNYPQLQYARGYDQNWVINGAYGK
QPRLAAQIFDPKTGRAMDVLTSQPGLQVYTSNSLDGTYYGKTGKQYRQTDAIAFEAEHYP
DSPNHPSFPTTELKPGQNFDYTTVFRFGVRR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttttctaagcatgtattaggcttatgctttggcttaactttgtctgtaata
acctttacatcctctgcccatagtgcccctacaaatgttagtttcagtcaagcgcctttc
ggaaaaacggctgaaggagaagcggtatcaatttatactttgaaaaatactaagggcgta
atcgttcggtttatttcctatgggggtattattcagtccatagaaacgcctgatcgtgat
ggtaaatcaggcgatattgtactcggttttgcagatttaaaaggctatactgtagatgcc
gcaaaaggcggtttattttttggggccctaattggtcgttatgcgaaccgcattgccaag
ggaacttatacacttcaaggtaagacttataatgtccctattaccgcgacccccaatgct
ttacacggtggtacgcgcggttttgataaatatgtgtggactgtgcgccctttacccgca
actgaacatgaagcgggtgctgtactaacgctagttagccctgacaatgatcaaggtttt
ccaggcacattaacggtacatgtaacctatacgcttaatgatcagaatgaattacggtta
cggtatcaagctacaacagataaaccgaccgttcttaatctcagcaatcatagttatttt
aatttagggggtgaaggatccggctcaatcgaagatgaaatcttaaaaattaatgccgat
aactatacacctactgatatgacttcaattccaacgggcgatattgtcagtgttgcaggg
acacctttggattttcgtaaccctatgcgtgtcggggatcatctacgcgataattatccc
cagcttcaatatgcacggggatatgaccaaaattgggttataaatggtgcttatggaaaa
cagcctcggttggcagcgcaaattttcgatcctaaaacggggcgtgcaatggatgtgctg
acatcacaacctggcttacaggtctatacctccaactcactggatggcacatattacggg
aaaacaggtaaacaatatcgtcagacagatgcaatagcctttgaagccgaacattatcca
gattcccctaatcatccttcttttcctacaaccgagcttaaacccggacagaattttgat
tatacgaccgttttccgtttcggtgttcgtcgttaa

DBGET integrated database retrieval system