KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0386Help
Entry
Zymop_0386        CDS       T01556                                 

Definition
putative CheA signal transduction histidine kinase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Zymop_0386
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Zymop_0386
Enzymes [BR:zmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Zymop_0386
Two-component system [BR:zmp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Zymop_0386
Bacterial motility proteins [BR:zmp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Zymop_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
446712..448403
Genome map
AA seq 563 aa AA seqDB search
MTEFPKRHFLLWEKQREQIAHDLKACQAGIYDDKMLNRLEAVATHLGKEAADSGDEAFAS
LAQHLAQLLTYLQNDKLVLNLFLIDLIQRSFEAIEAYITALNSGLSLPDHAKLDTELQEN
LASSSEWALKKVGVDIATDAPSDSPTISLPLIRPPSKATPDGQCINQSVAESSIYVEGSN
LPHIPIDPDKLDGLFKIFNEMLSIRASLSEGNASNIESRNQDNDLDKLDDLIQSANNYTL
SLQTQKIEGLFSQIIPIIEHRYAQKNKFITFSIIGGDTKIDKRIVISVGEALLELVDNAA
LHGIESAEDRQKVSKPENGRICLEAKCHASRLRIAITDDGRGIIWENLITLAEKYGLIAD
KDKENNKDTKIFKSIYKQKEKSGLAHVKRIIQSLRGEVSIYAPPNIGTRVTLFLPLNQMM
IEGLIARVKQQSYIFPISDITESIAVEPKDIHWVDDKQSMIKLRDKWLPAIALSSLIGGE
TFHKDSFKEGRKILIHVDSTIHQPEITLIVDTIESQRQLVVQNLETNFQAVRGITGAALM
ENGEMALVVDLESLLHSPPPQYT
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattccccaaaaggcattttcttttatgggaaaagcagcgagagcaaattgcc
catgatttaaaggcctgtcaggctggaatctatgatgacaaaatgcttaatcgcttggaa
gccgttgccacgcatttaggtaaagaagcggctgacagtggggatgaagcgtttgctagt
ctggcacagcatctagctcaattacttacctatcttcaaaatgataaacttgtcttaaat
ctgtttctgattgacttaatacagcgcagttttgaagctattgaggcctatatcacagct
ctgaattcgggtctctcactacccgaccatgcgaaattggataccgagttacaagaaaat
ttagcgtccagttccgaatgggcccttaaaaaagttggtgtagatattgctacggatgcc
ccgtcagattcccccacaatatcactgcctttgatccgtccgccttccaaggcaacacct
gatggacaatgtatcaatcagagtgtcgctgagagttctatttacgttgaaggcagtaac
ttaccgcatatccccattgatccagataaactcgacggattattcaagatattcaatgaa
atgttgagtattcgagcctctttatctgaaggaaatgcgtcaaatatagaaagccgtaat
caggataatgatcttgataaactcgatgatttaattcaatcggccaataattatacgctt
tcgttgcaaactcaaaagatagaaggattattttctcaaattatcccgattatcgagcat
cgttatgcccaaaaaaataagtttattactttttcgataataggtggtgataccaagatt
gataaacgtattgttatttccgtgggagaagctttgcttgaattagtcgataatgcggca
ttgcacggaattgaatcagcagaagatcggcagaaggtcagtaaacctgaaaatggtcgt
atctgcttagaggcaaaatgccatgccagccgtcttagaattgcaataacggatgatgga
cgtggtattatctgggaaaatctgattactctagccgaaaaatatggattgattgcggat
aaagacaaagaaaataataaagacactaaaattttcaaaagtatttataaacaaaaagaa
aaaagcggattggctcacgtaaaacgtatcatccaatctttaaggggggaggtaagtatt
tatgcgccccccaatataggcacgcgcgttacgttgtttttacctcttaaccaaatgatg
atagaaggtttaatcgctagagtaaaacaacaaagttatattttcccgatctctgatatt
actgaaagtattgctgttgaaccaaaggatattcactgggtcgacgataaacaatcgatg
ataaaattacgagataaatggctacctgctattgccttatcctcgttaatcggcggagag
acctttcataaagattcctttaaggaagggcgaaaaatactcattcatgttgattctact
attcatcaaccagagattacgcttattgtagatacaattgaaagccagagacagcttgtt
gtccaaaatctggaaacgaattttcaagcggtgcggggtattaccggagcagctctgatg
gaaaatggcgagatggctttagtcgtagatctagaatccttgctacattctccaccccct
caatatacctaa

DBGET integrated database retrieval system