KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0461Help
Entry
Zymop_0461        CDS       T01556                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Zymop_0461
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Zymop_0461
Enzymes [BR:zmp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Zymop_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(533266..534225)
Genome map
AA seq 319 aa AA seqDB search
MSLNSSFPHRHLLGIAPLSAPEIHFLLDEAERWVALNRAAAVKHDDSLAGLTQINAFFEN
STRTLLSFEIAGKRLGADVVNMAVAQSSVKKGETLIDTAVTLNAMHADMLVIRHQASGAV
QLIADKVDCPVLNAGDGQHEHPTQALLDALTIRRRKGRIEGMIVAICGDIMHSRVARSNM
IALKKLGAHVRVVAPPTLMPDHIESFGVEVFSELDQAIAGADVVMMLRLQRERMSGGFIP
SLREYHALFGLTVEKLQLAADDALVMHPGPLNRGVEIDSAVADDPKHSAITEQVEMGVAV
RMACLDVLTRQRRAVKGWA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaaattcttcttttccccatcgccatttacttggcatagcgcctttatcggct
cctgaaattcattttctgctggatgaggccgaacgctgggttgcccttaatcgggcagcg
gcggttaaacatgatgatagtttggccggattgacccaaattaacgctttttttgaaaat
tcgacccgaacattgctctctttcgagattgcaggcaaacgtttaggggcggatgtcgtc
aacatggcggtagcccaatcaagcgttaaaaaaggcgaaaccctgatagacacagcagta
acgctgaatgccatgcacgcggatatgcttgttattcgtcatcaggcatcaggcgcggta
cagctgatcgctgataaggtcgattgtccggtgctgaatgcgggcgatggccaacatgaa
catcctacgcaagctttattggatgccctgactatccgtcgtcgtaaggggcggattgaa
ggtatgatcgtcgcaatttgtggcgatattatgcacagtcgagtcgcccgatccaatatg
attgcgttgaaaaagctaggcgctcatgtgcgggttgttgcgccgcctacgctgatgccg
gatcacatagaatcttttggtgtagaggtcttttccgaactcgatcaagcgattgcgggt
gctgatgttgtgatgatgctccggctacaacgcgaaagaatgtcgggtggttttattcct
tccttgcgggaatatcatgccttatttggcttaaccgttgaaaaactacagcttgcagct
gatgatgccttggttatgcatcccggtccattaaatcgtggtgtcgagattgattccgct
gttgccgatgatcccaaacattctgcgattacagaacaagtcgagatgggtgttgctgta
agaatggcctgtcttgatgtgttaacccgtcaaagacgtgctgtgaaaggctgggcatga

DBGET integrated database retrieval system