KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0508Help
Entry
Zymop_0508        CDS       T01556                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Zymop_0508
Enzymes [BR:zmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Zymop_0508
Transfer RNA biogenesis [BR:zmp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Zymop_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585269..586087)
Genome map
AA seq 272 aa AA seqDB search
MLIPSLSPQAALLEGLVQIALQAGEKALEIYHGDFTVMTKEDDSPVTRADREAEAIILEG
LKKLQPGVAVIAEEQYAATKKGYNTDSFFLVDPIDGTKEFINKRDEFTVNIALIKKGMPI
LGVIYAPATGQIYGGDVLAKSAWTAKVEPNQEFLNHTAITTRQPSEKLDVMTSFSHNNPA
TEAYLDSLPVGERIKAGSSLKFCWLAEGKADIYPRLSPTHEWDTAAGHAILLAAGGNVVT
VDGEALLYGKPGYLNPGFIAYGAEQPLLPPQS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttataccatcactttcacctcaggccgctttattggaaggattagttcaaatcgcc
ttacaggccggtgaaaaagctctagaaatttatcatggtgacttcactgtcatgactaag
gaagacgacagtcccgtcacccgtgcagatcgggaagccgaagctatcattttagaagga
ttgaagaagctgcagccgggtgtcgctgtcatcgcggaagaacaatatgctgcaacaaaa
aaagggtacaacacagacagcttctttttagttgatcccatcgatggaaccaaagagttt
attaataaacgggatgaattcacggttaatattgccctcatcaaaaagggtatgccgatt
ttgggggttatttatgcgcctgctaccggccagatatatggaggcgatgtcttggcaaaa
tctgcatggaccgcaaaagttgaacctaatcaagaatttttaaatcacacggctattacg
acccgtcaacctagtgagaagctagatgttatgacctctttttctcataataatccggcg
acagaggcttatttggatagcttaccggttggagaaagaataaaggcgggatcttcattg
aaattttgctggttggcagaaggaaaagccgacatctatccccgtttatcgccaacccat
gaatgggatacggctgccggacatgccattcttttggccgctggtggcaatgttgtaact
gttgacggtgaagctttactctatggaaagcccggttatctaaatcccgggtttattgct
tatggggcagaacagcctttattaccccctcagtcttaa

DBGET integrated database retrieval system