KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0634Help
Entry
Zymop_0634        CDS       T01556                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Zymop_0634
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zymop_0634
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zymop_0634
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Zymop_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726802..728028
Genome map
AA seq 408 aa AA seqDB search
MKHTTSVLPNSLRAQPDTNGHFGQFGGRYVPETLMPLILELDQEYRRAIKDPAFIAERDD
LLEHYVGRPSPLYFAARLTEAWGGAKVYLKREDLNHTGAHKINNCIGQILLAKRMGKTRV
IAETGAGQHGVATATVAARFGLSCTVFMGELDTERQQPNVFRMKLLGAEVRPVKAGARTL
KDAMNEALRDWVAHIDDTFYILGTAAGPHPYPELVRDFQSVIGREAREQIQKAEKRLPDL
LIAAVGGGSNAIGLFHPFLDDTNVAMVGVEAAGEGLETGRHAASLNGGAPGIVHGNRTYL
LYDENGQIKDAHSISAGLDYPGIGPEHSWLKDIKRVKYETITDDEAIEAFQTLCRLEGII
PALESSHALAAAAKIAPTMDKDKIIIVNLSGRGDKDIFTVARHLGVTL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacaacttctgttcttccaaactctttgcgggcgcaacccgatacaaacggc
cattttggccaattcggaggacgctatgtccccgaaaccctgatgcctctgattttagaa
ttagatcaggaatatcggcgtgccatcaaggaccccgcctttattgctgaacgggatgat
cttttagaacattacgttgggcgtcccagccccctttattttgcagcacgtctgacagaa
gcatggggtggggctaaggtttatctgaaacgcgaagacttaaatcacaccggcgcccat
aaaattaataattgcatcggtcagattcttcttgccaaaagaatgggtaaaacccgcgtc
attgctgaaacgggtgccggtcaacatggcgtggcaacagcaacggttgccgctcgcttt
ggtctttcttgcactgtctttatgggagaactggatacagaacggcagcaaccgaatgtt
ttccgaatgaaattgctaggggcagaggttcggccagtcaaagcgggtgcacgtacgtta
aaagacgccatgaatgaagcgttgagagattgggtcgcccatattgacgatactttctat
attttggggacagcagcgggcccccatccctatccagaattagtgcgcgactttcagtcg
gtgattggccgtgaagcgcgggaacaaatccaaaaagcagaaaagcgcttacccgattta
ttgattgccgctgtgggcggcggttccaatgcaatcggtctttttcaccctttccttgac
gatacgaatgttgccatggttggggtagaagccgccggtgaaggtcttgaaacaggccgt
cacgctgccagtttaaacggtggagcgccgggaattgtccatgggaatcgcacttatttg
ttatatgatgaaaacgggcagatcaaagatgcacactccatttcagcagggctcgattac
cccggaataggccctgaacacagctggttgaaagatataaagcgtgtaaaatacgaaact
attaccgatgatgaagcaattgaagcgtttcaaactctttgccgattagaagggattatt
ccagcattggaatcttctcacgctttggcagcggcggcaaaaattgcgccgacgatggat
aaagacaagattattattgttaatctttcgggacgaggtgataaagatattttcacagtg
gcccgccatttaggggttacattatga

DBGET integrated database retrieval system