KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0635Help
Entry
Zymop_0635        CDS       T01556                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00260  Glycine, serine and threonine metabolism
zmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01130  Biosynthesis of antibiotics
zmp01230  Biosynthesis of amino acids
Module
zmp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zymop_0635
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zymop_0635
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Zymop_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth NMO Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: AEI37537
UniProt: F8ERS9
Position
728025..728849
Genome map
AA seq 274 aa AA seqDB search
MSRITDVFAKAKKDNRAALIAFITAGDPTPDKTPDLLDKLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTSHDDIFAIAADFRKRHPNTPLILMGYANTMTFKGSDDFSSRAKK
SGIDGVICVDIPPEEDATLGIDIRKYGLDMIRLATPTSDEKRLKTILHGATGFLYYVSVA
GVTGLQQATEASITSAMDRIKAVTDLPVAVGFGIRTAEQAAAVAQKADAVVVGSAFVNKI
EDAVRQNQDPAPALAQLAQMLSTAVCHARKEKVA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattacagacgtttttgcaaaagccaaaaaagacaatcgtgctgctttgatt
gcttttattacagcgggcgaccctacccctgataaaacccctgatttgctggataaattg
gtggaaaatggggtcgacattatcgaattagggatgcctttttccgatccgatggccgat
ggccccgctatccaaaaggctaatctgcgggctttagcggccaaaaccagtcatgatgat
atttttgctattgcggccgattttagaaagcggcatcctaatacgcctctgattttaatg
ggctatgccaatacaatgacttttaagggaagtgatgacttctcaagtcgggctaaaaaa
tcaggcatagacggggttatttgcgtcgacatcccccccgaagaagatgcaacattaggg
atcgatattcggaaatatggattagatatgatccggctggcaacccccaccagcgatgaa
aaaaggctaaaaactattctccatggtgctacgggctttttatactatgtttccgtcgct
ggtgtcacaggcttacagcaagcaacagaagcgagcataacttctgctatggaccgcatc
aaggcagtaacagatttacccgtggcagttggttttggtatcagaacggctgaacaagcg
gcagcggttgctcaaaaagccgatgcggttgtcgttgggtctgcttttgtcaacaagatt
gaagacgctgttcgtcaaaaccaagacccagcccctgccttagcccagctagcacaaatg
cttagtacggctgtctgtcatgcgcgcaaggagaaagtagcatga

DBGET integrated database retrieval system