KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0635Help
Entry
Zymop_0635        CDS       T01556                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Zymop_0635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zymop_0635
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zymop_0635
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Zymop_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728025..728849
Genome map
AA seq 274 aa AA seqDB search
MSRITDVFAKAKKDNRAALIAFITAGDPTPDKTPDLLDKLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTSHDDIFAIAADFRKRHPNTPLILMGYANTMTFKGSDDFSSRAKK
SGIDGVICVDIPPEEDATLGIDIRKYGLDMIRLATPTSDEKRLKTILHGATGFLYYVSVA
GVTGLQQATEASITSAMDRIKAVTDLPVAVGFGIRTAEQAAAVAQKADAVVVGSAFVNKI
EDAVRQNQDPAPALAQLAQMLSTAVCHARKEKVA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattacagacgtttttgcaaaagccaaaaaagacaatcgtgctgctttgatt
gcttttattacagcgggcgaccctacccctgataaaacccctgatttgctggataaattg
gtggaaaatggggtcgacattatcgaattagggatgcctttttccgatccgatggccgat
ggccccgctatccaaaaggctaatctgcgggctttagcggccaaaaccagtcatgatgat
atttttgctattgcggccgattttagaaagcggcatcctaatacgcctctgattttaatg
ggctatgccaatacaatgacttttaagggaagtgatgacttctcaagtcgggctaaaaaa
tcaggcatagacggggttatttgcgtcgacatcccccccgaagaagatgcaacattaggg
atcgatattcggaaatatggattagatatgatccggctggcaacccccaccagcgatgaa
aaaaggctaaaaactattctccatggtgctacgggctttttatactatgtttccgtcgct
ggtgtcacaggcttacagcaagcaacagaagcgagcataacttctgctatggaccgcatc
aaggcagtaacagatttacccgtggcagttggttttggtatcagaacggctgaacaagcg
gcagcggttgctcaaaaagccgatgcggttgtcgttgggtctgcttttgtcaacaagatt
gaagacgctgttcgtcaaaaccaagacccagcccctgccttagcccagctagcacaaatg
cttagtacggctgtctgtcatgcgcgcaaggagaaagtagcatga

DBGET integrated database retrieval system