KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0649Help
Entry
Zymop_0649        CDS       T01556                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Zymop_0649
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Zymop_0649
   00650 Butanoate metabolism
    Zymop_0649
  Energy metabolism
   00190 Oxidative phosphorylation
    Zymop_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750162..750533
Genome map
AA seq 123 aa AA seqDB search
MKDSLSPTPPIDRDKKADFYKQLTALANVFLYSWLIISFFRLPSYDFNLVRRWLGQAIVA
IPIVLLVFSTYGYARFFVDTLFPSPSYRKIRNSLQLILYFYMIIVGSFAIFSVLKIAFHS
GIS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacagcctcagcccgacaccccctatagacagggataaaaaagctgatttttat
aaacagctaacagccttggcgaatgtcttcttatacagttggttaattatctcgtttttt
cggttgccgtcttatgactttaaccttgtgcggcggtggcttggccaagctatcgtggcc
atacccatagtgctcttggtgttttctacgtatggttatgcccgattttttgtcgatacg
ctttttccttcgccttcttatcgtaaaataagaaatagtcttcagcttatcctctatttt
tatatgataatcgtagggagttttgctattttttctgttttgaaaattgcttttcattca
ggcataagctga

DBGET integrated database retrieval system