KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0649Help
Entry
Zymop_0649        CDS       T01556                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00020  Citrate cycle (TCA cycle)
zmp00190  Oxidative phosphorylation
zmp00650  Butanoate metabolism
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01120  Microbial metabolism in diverse environments
zmp01130  Biosynthesis of antibiotics
zmp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Zymop_0649
   00650 Butanoate metabolism
    Zymop_0649
  Energy metabolism
   00190 Oxidative phosphorylation
    Zymop_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EutH
Motif
Other DBs
NCBI-ProteinID: AEI37551
UniProt: F8ERX6
Position
750162..750533
Genome map
AA seq 123 aa AA seqDB search
MKDSLSPTPPIDRDKKADFYKQLTALANVFLYSWLIISFFRLPSYDFNLVRRWLGQAIVA
IPIVLLVFSTYGYARFFVDTLFPSPSYRKIRNSLQLILYFYMIIVGSFAIFSVLKIAFHS
GIS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacagcctcagcccgacaccccctatagacagggataaaaaagctgatttttat
aaacagctaacagccttggcgaatgtcttcttatacagttggttaattatctcgtttttt
cggttgccgtcttatgactttaaccttgtgcggcggtggcttggccaagctatcgtggcc
atacccatagtgctcttggtgttttctacgtatggttatgcccgattttttgtcgatacg
ctttttccttcgccttcttatcgtaaaataagaaatagtcttcagcttatcctctatttt
tatatgataatcgtagggagttttgctattttttctgttttgaaaattgcttttcattca
ggcataagctga

DBGET integrated database retrieval system