KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0671Help
Entry
Zymop_0671        CDS       T01556                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Zymop_0671
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zymop_0671
Enzymes [BR:zmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Zymop_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
778476..779270
Genome map
AA seq 264 aa AA seqDB search
MSNILTEICATKARHVADKKKHISETDLYNLTKNQTAPRGFRAALDKKRAEGKFSLIAEI
KKASPSKGLIRPDFEPILHARSYQEGGAACLSVLTDQPYFQGHEDYLIAARNEVTLPVLR
KDFMIDPWQVTEARAIGADAILIIVAALEDNQMQEIEAAALEYGMDALIEVHSTQEMERA
LRLKSRLIGVNNRDLRDFSVSFDRTYELIKQAPKECTFVAESGIQTHDDLVAMNQHNIGC
FLVGETLMRQKDVKQATRDLLGLN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattcttacagaaatttgtgctaccaaagcacgccacgttgcagacaaaaaa
aagcatatcagtgaaactgatctttataatttgacgaaaaatcagactgccccgcgaggt
tttcgcgctgctttagataaaaaaagagctgagggtaaatttagtttaatcgctgaaata
aagaaagctagcccctccaaaggcctaatccgtccagattttgagcctattcttcatgct
cgttcctatcaggaaggcggtgcggcctgtctatcagttttgactgaccagccttacttc
caaggccatgaggactatttaattgcggcacggaatgaagtgacgcttcccgttttacgc
aaagattttatgatcgatccttggcaggttacagaagcccgcgccatcggtgccgatgcg
atattaattatcgtggctgctttagaggacaaccagatgcaagaaatcgaagccgccgcc
ttagaatatggaatggatgccttgatagaggtgcatagcacacaggaaatggaacgcgct
ttaaggttaaaatcgcgtcttatcggggtaaataatcgggatttaagagatttttcggtt
agctttgaccgaacttacgaactgatcaaacaggcgccgaaagagtgcacttttgtggcg
gaaagtggaatccagacccatgatgatttagtggcaatgaatcagcataatattggttgt
tttttagtcggggaaacccttatgcgtcagaaggatgtaaaacaggcaacccgtgactta
ttgggattaaactaa

DBGET integrated database retrieval system