KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0671Help
Entry
Zymop_0671        CDS       T01556                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01130  Biosynthesis of antibiotics
zmp01230  Biosynthesis of amino acids
Module
zmp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Zymop_0671
Enzymes [BR:zmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Zymop_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: AEI37573
UniProt: Q9XBM3
Position
778476..779270
Genome map
AA seq 264 aa AA seqDB search
MSNILTEICATKARHVADKKKHISETDLYNLTKNQTAPRGFRAALDKKRAEGKFSLIAEI
KKASPSKGLIRPDFEPILHARSYQEGGAACLSVLTDQPYFQGHEDYLIAARNEVTLPVLR
KDFMIDPWQVTEARAIGADAILIIVAALEDNQMQEIEAAALEYGMDALIEVHSTQEMERA
LRLKSRLIGVNNRDLRDFSVSFDRTYELIKQAPKECTFVAESGIQTHDDLVAMNQHNIGC
FLVGETLMRQKDVKQATRDLLGLN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattcttacagaaatttgtgctaccaaagcacgccacgttgcagacaaaaaa
aagcatatcagtgaaactgatctttataatttgacgaaaaatcagactgccccgcgaggt
tttcgcgctgctttagataaaaaaagagctgagggtaaatttagtttaatcgctgaaata
aagaaagctagcccctccaaaggcctaatccgtccagattttgagcctattcttcatgct
cgttcctatcaggaaggcggtgcggcctgtctatcagttttgactgaccagccttacttc
caaggccatgaggactatttaattgcggcacggaatgaagtgacgcttcccgttttacgc
aaagattttatgatcgatccttggcaggttacagaagcccgcgccatcggtgccgatgcg
atattaattatcgtggctgctttagaggacaaccagatgcaagaaatcgaagccgccgcc
ttagaatatggaatggatgccttgatagaggtgcatagcacacaggaaatggaacgcgct
ttaaggttaaaatcgcgtcttatcggggtaaataatcgggatttaagagatttttcggtt
agctttgaccgaacttacgaactgatcaaacaggcgccgaaagagtgcacttttgtggcg
gaaagtggaatccagacccatgatgatttagtggcaatgaatcagcataatattggttgt
tttttagtcggggaaacccttatgcgtcagaaggatgtaaaacaggcaacccgtgactta
ttgggattaaactaa

DBGET integrated database retrieval system