KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0751Help
Entry
Zymop_0751        CDS       T01556                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Zymop_0751
   01230 Biosynthesis of amino acids
    Zymop_0751
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zymop_0751
   00051 Fructose and mannose metabolism
    Zymop_0751
   00562 Inositol phosphate metabolism
    Zymop_0751
Enzymes [BR:zmp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Zymop_0751
Exosome [BR:zmp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Zymop_0751
  Exosomal proteins of bladder cancer cells
   Zymop_0751
  Exosomal proteins of melanoma cells
   Zymop_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859263..860015
Genome map
AA seq 250 aa AA seqDB search
MTIRKLIAGNWKMNGSLGMLHELDDIAQATFKHPELDVVLCPSFTLIAPAIGRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRMEQNETNEEIRAKTITAMANGLI
TIVCIGESRAAHASGQALPIIGAQLDGCIPTDATSESLVVAYEPIWAIGTGHTPPPENIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAAELLSIPEVNGTLVGGASLTAKQFVP
IIEAGASVVA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgatacgcaagctaatcgccggtaactggaaaatgaacggctcactagggatgctc
cacgaactggacgatatagctcaagctacatttaaacatccagaacttgatgttgtgctt
tgtccttcttttacgctgattgcgcctgctattggtcgtcagccagatatgacctttggg
gcacaagattgccattatgatgagagtggctctcatacagggtgtgtgtcggctccgatg
ttaagagaagttggggctagctatgttatcgttggtcatagcgagcgccgtatggaacaa
aatgaaactaatgaagaaatccgtgccaagaccattacagcaatggccaatggattaatc
acgatcgtttgtatcggagagtctcgggcagcgcatgcgtccggtcaagcccttcctatt
atcggcgcacaattggacggatgtattcccactgatgccacgagtgaaagtctggttgtg
gcttatgagcccatttgggctattggaacaggtcatacacccccgcctgaaaatatagca
gaaatgcatgcctcgattcgagatcgattatgtctgttattaggcagtgaaggtaaaaaa
gtccgtattttatatggggggtctgttacgggtaaaaatgcagccgaacttcttagcatt
cccgaggtcaatgggaccctggtagggggggccagtttaacggcaaagcaatttgttcca
attatcgaggcgggtgcctctgtggtggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system