KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0777Help
Entry
Zymop_0777        CDS       T01556                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Zymop_0777
Enzymes [BR:zmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Zymop_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886095..886748
Genome map
AA seq 217 aa AA seqDB search
MPSANFRLARRGLLFVISSPSGAGKSTIARKLLEEDDEIHLSVSVTTRPMRPGEIDGVDY
HFVDVPEFKKMVAEDQLLEWAHVFDNRYGTPRKPVEEMVHKGQDVLFDIDWQGAQQLWQQ
ASGDTIRVYILPPSVEELERRLRGRGTDSEEVIKKRMARAASEISHWDGYDYVLINDDIE
ECFQQVRNILKVERIKRRRQIGLIGFTRKLLAPPEDK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagctaacttccgtcttgcccgtcgtgggctacttttcgttatttcctcacct
tctggtgcaggtaagtccactattgctcgcaaattacttgaggaagacgatgaaattcat
ctgtctgtctcggtcaccacccgtcccatgcgtcccggcgaaatagacggtgtcgattat
cattttgttgacgtccctgaatttaaaaagatggtcgctgaagaccaacttcttgaatgg
gcgcatgttttcgataatcgttatggaacgccccgaaaacctgtcgaagaaatggtgcac
aaaggacaagatgtcctgtttgatatagattggcagggtgcacaacaattatggcagcaa
gccagtggtgataccattcgtgtctatattttacccccttccgttgaagaattagaacgg
cgtctaagagggcgtggtaccgattctgaagaggttatcaaaaaacgaatggcgcgcgcc
gccagtgaaattagtcactgggatggctatgactatgttttgatcaatgatgatattgaa
gaatgcttccaacaagtcagaaatatcttgaaagttgaacgtattaagcgtcgtcgccag
attggtttaatcggctttacccgaaaattattggcaccgcctgaagataaataa

DBGET integrated database retrieval system