KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0830Help
Entry
Zymop_0830        CDS       T01556                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Zymop_0830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Zymop_0830
   00052 Galactose metabolism
    Zymop_0830
   00500 Starch and sucrose metabolism
    Zymop_0830
   00520 Amino sugar and nucleotide sugar metabolism
    Zymop_0830
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Zymop_0830
   00524 Butirosin and neomycin biosynthesis
    Zymop_0830
Enzymes [BR:zmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Zymop_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(942093..943067)
Genome map
AA seq 324 aa AA seqDB search
MEIVAIDIGGTHARFALAEVSGGKVVSLGTETTFKTAEHASLQLAWERFGEKLGRPLPRA
AAIAFAGPVHGEVLKLTNNPWVLRPATLNEKLNVDSHILINDFGAVAHAVAHMDASYLGH
ICGPDEALPAEGVITILGPGTGLGVAHLLRTEGRYFVIETEGGHIDFAPLDKLEDKVLAR
LRERFRRVSIERIVSGPGLGNIYEALAAIEGVPFSLLDDVKLWQMALEGKDNLAEAALDR
FCLSLGAIAGDLALAQGASGVAIGGGVGLRIAGHLPGSGFRQRFVSKGRFERVMSKIPVK
LITYPQPGLLGAAAAYANKYSDVE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgttgcgattgatattggtggaacgcatgcgcgtttcgctcttgcggaagtc
agtggtggtaaagttgtttctttgggaacggaaacaacgttcaaaacagctgaacatgct
agcttacagttagcttgggaacgttttggtgaaaagcttggtcgtcctttacctcgggct
gccgcgattgcttttgcgggtcctgtacatggtgaagttttaaagctgacgaataaccct
tgggtattacgtcctgctacgctgaatgaaaaattgaatgttgattcccatatccttatc
aacgattttggtgctgtagcccatgccgttgcgcatatggatgcttcttatttaggccat
atttgtggtcctgatgaagccttacctgctgagggggttatcaccattcttgggccggga
acgggtttaggcgtagcccacctgttgcgcacagaaggtcgctatttcgtcattgagacg
gaaggcgggcatatcgattttgcgcctttggataagcttgaagataaggttttagcccgt
cttcgtgaacgtttccgccgggtttctatcgagcgtattgtttctggaccaggtcttggc
aacatttatgaagctttagctgcaatcgaaggtgttcctttcagccttcttgatgatgtt
aaactttggcagatggctctcgaaggcaaagacaacttggccgaagccgctcttgatcgt
ttctgcttaagcttgggcgctatcgcaggtgatcttgccttggcacagggtgcctctggt
gttgctatcggcggtggtgttggtctgcgtattgccggtcatttaccaggatctggcttc
cgtcagcgctttgtatccaaaggtcgctttgaacgcgttatgtctaaaattccggttaag
ttgattacttatccgcagcctggcttattgggtgctgccgccgcctatgccaataaatat
tctgacgttgaatag

DBGET integrated database retrieval system