KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0869Help
Entry
Zymop_0869        CDS       T01556                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zmp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:zmp00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(997474..997983)
Genome map
AA seq 169 aa AA seqDB search
MTIQPEIMLILARARNGVIGHQNKMPWHIPADLRHFKRLTINHPMIMGRQTFESLPGLLP
DRPHIVLTHNMNWQAEGCEVAHNLDQAIEIALRYSSRIAIIGGAQIFKQSWSLADYIELT
EIEKDYTGDTYVDLPDMSGFSLESQQDYDAESGQPAFCFKRFMKRKIMP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcaacctgaaattatgcttattctggcccgggctcgaaacggcgttattgga
caccaaaataaaatgccatggcatattccggcagatctaaggcattttaaacgtttaaca
atcaatcaccctatgattatggggcggcaaacttttgaaagtctgcccgggttattgccc
gatagacctcatattgttttgacccataatatgaattggcaagcagaaggatgtgaggtt
gctcataatcttgatcaggccattgaaatagccctccgttacagttctagaatagcgatc
attgggggtgcccaaatttttaaacaaagttggtctttagcggattatattgaactcact
gaaattgaaaaagactatacgggtgatacctatgtggacttacccgatatgtctggtttt
tctttagaaagtcagcaagattatgatgcggaatcagggcaacctgctttttgttttaag
cgttttatgaaacgaaaaataatgccataa

DBGET integrated database retrieval system