KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1108Help
Entry
Zymop_1108        CDS       T01556                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:zmp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:zmp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1296450..1297502)
Genome map
AA seq 350 aa AA seqDB search
MTVRVLIVDDSPTMRAILSMMISLDPEIEVVGKADCPSTARQMIKELNPDVMTLDIEMPG
MDGLDFLEKVMRLRPMPVIMVSALTAAGAEATLKAMELGAFDCFAKPALGFASDRSQSLA
LIEMIKAAAKSGGHRPIFRRHSSNATQVKSSSVSSSGYRPKPGSIIAIGASTGGVETLLA
LLKDFPENCPPTLIVQHMPPLFTTSFANRLNRMCPPTVSEAKTGDPLIPGHVYVAPGGDR
HLEFQNAAHGPRCILVADEPMSGHRPSVDRMFLSVAKNCGRRAVGVILTGMGQDGAIGLK
AMRDTGSFTIGQDEESCVVYGMPAAAFKQGAVEVQLSLSKIAARALEACA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcagagtacttattgtggatgactcgccaacgatgcgagctatcctatcgatg
atgatttcattagacccagaaattgaagtggttggtaaggccgattgtccctctacagcc
cgacaaatgattaaagaacttaatcctgacgtcatgactttagatattgaaatgccgggt
atggacggtcttgattttctagaaaaagtgatgcgtctgcgcccgatgccggttattatg
gtatcggctttaacggctgccggtgctgaggcgaccttgaaagccatggaactaggggct
ttcgattgttttgctaaaccggccttaggctttgcatcggatagatctcagagtcttgct
ttgattgagatgattaaggcagcggccaaatctggcggacatcgtcctattttccggcgg
cattcttctaatgctacacaggtaaaatcttcctctgtgtcgtcctctggctatcgtcca
aagccgggcagtatcatcgcaatcggtgcttccaccggcggcgttgaaactttactggca
ttattgaaagattttcccgagaattgtccgccgaccttgattgtgcagcatatgcctcct
ttatttacgactagttttgctaatcgtttgaaccggatgtgcccgcctacggtctcggaa
gctaaaacaggcgaccctttgattcccgggcatgtatatgtagcccccgggggtgatcgt
catcttgagtttcaaaatgccgcccatgggccgcgttgtattctggtcgccgatgagccg
atgagtggtcatcggccttctgtggatcgtatgtttttatctgttgcaaagaattgcggg
cgacgggctgtcggtgttattttgaccggtatgggacaagatggcgcaataggtttaaaa
gctatgcgtgatacaggttcttttacgattggtcaggatgaagaaagttgtgtggtttat
ggaatgcctgcggcggcttttaagcaaggcgctgttgaggttcagttatctttatctaag
attgcagcccgtgctttggaagcctgtgcctga

DBGET integrated database retrieval system