KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1219Help
Entry
Zymop_1219        CDS       T01556                                 

Definition
Uroporphyrinogen-III synthase-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Zymop_1219
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Zymop_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429208..1429945
Genome map
AA seq 245 aa AA seqDB search
MPFTRIDTDYQASSRHLLILRPEPGASRTAKQAIAAGWRVTKTPLAEAIPLSWALPSPAS
YEAVMVTSAQAIYHGGAELQKLVNYPLYAVGKTTAQAAVDAGFSHIIVANGNGESLIERL
KQDGRTRILRLCGEIHKTYLAEKSEFQENQTFFLQIVYKMQDIDCLPMAACQALTQQAIV
LLHSSRFAERFRFLLKKTNINPDRVPIAVISPTVAEQVGKTWQATAVAEYPDDIHLLKAA
ASLEL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgccatttacaaggatagatacggattatcaggcatcttcccgccatttgttgattcta
cgtccggaaccgggtgctagtagaaccgcaaaacaggcgattgctgctggatggcgtgtg
actaaaacacctttagcggaggccattcccctttcatgggcattaccctctccggcttct
tatgaagctgtcatggtcacgagtgctcaagctatttatcatggcggcgctgaattacaa
aaattagtcaattatccgctttacgccgtaggcaaaacgacggcgcaagcggctgttgat
gccggattttctcatattattgtggccaatggtaacggagaatctttgattgaacgttta
aagcaagatggacggactcggatattgcgtctttgtggtgaaatccataaaacttatctt
gcggaaaagagtgaatttcaggaaaatcagacgttttttttacaaatcgtttataaaatg
caagatattgactgtttaccgatggctgcctgtcaggcattaacacaacaggctatcgtt
ttattacattcttcacgatttgcagaacgctttcgttttttattaaaaaaaacgaatatc
aatccagatagggttccgattgcagttatcagtccaactgtagcggagcaggtaggaaaa
acgtggcaagccactgctgttgcagaatatccagatgatattcatctgttaaaagccgca
gcaagtttagagttatga

DBGET integrated database retrieval system