KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1229Help
Entry
Zymop_1229        CDS       T01556                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Zymop_1229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zymop_1229
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Zymop_1229
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Zymop_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439048..1440445
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPESWPQFSREEIAALAGLSYVDTAVAVMR
PFVAGVLDDQALKNLCEAAYSQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLAGSEGQDLTIVGATSGDTGSAAISAVAGRAGVRIIMLHPNGRVSEVQRRQMTT
VLDDNVFNVAIDGSFDDAQAIVKAMFNDTEFRKRHRLGAVNSINWARLMAQIVYYFYSAV
RLGAPDRKVAFSVPTGNFGDVFAGYVASQMGLPIERLIVATNINDILYRALSAGDYSVGS
VTPTDAPSMDIQISSNFERLLFDLHGRDAHALADTMKTFEQSRAIRLSEAMRQQAAALFS
SSRIDPDGMAAAMRWASEKAGQVIDPHTAIGLAAARTTELPDDVSVVTLATAHPAKFPDA
VARITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDGGCKL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaagaggcgcggcagccgcgcaggatttcaaaggcgttactcta
accggtcttgcctctgatggtggtctttatgtgccggaaagctggccgcaattcagccgt
gaagagatcgctgctctggctggtttatcctatgtggatactgcggttgcagttatgcgg
ccgttcgtcgccggtgtgcttgacgatcaggctttaaaaaatctgtgcgaagccgcttat
agtcaatttaatcatgcagccgttacaccgcttgttcaactggatgaacggcattttctg
cttgaattattccatgggccgactttggcttttaaagatgtcgctttacaactgctgggt
catttgtttgaaaaatttttggccggtagcgaaggacaggatctgacgattgttggtgct
acttcaggcgatacggggtcggcggctatttctgctgtagcaggccgtgccggtgtccga
atcattatgctccatcctaatggtcgtgtttctgaagtgcagcgtcgtcaaatgacgacg
gttcttgatgataatgtctttaatgtcgccattgatggcagctttgatgatgcgcaagct
atcgttaaagccatgtttaatgataccgaattcagaaaacgccatcgtttaggggcggta
aactcgatcaactgggcgcgccttatggcgcaaattgtttactatttttattcagctgtt
cgtcttggcgcacctgatcgcaaagttgctttctcggtacctacgggtaatttcggggat
gtctttgcgggttatgttgccagccagatgggcttacctattgaacgcttgatcgttgca
actaacatcaatgatattctttatcgcgcgttgtcagcgggggattattctgtaggcagt
gtcaccccaacagatgcaccctcaatggatattcagatcagctctaattttgaaagattg
ctttttgatcttcatggccgcgatgcacatgcgctagcagatactatgaaaacctttgag
cagagccgtgctatccgtctttcggaggctatgcgccagcaagcggctgcgttattcagc
agcagccggatagatcctgatggtatggcagcggccatgcgttgggcttctgaaaaagca
ggacaggttatagatccccatacagcgattggtctggcggctgcacggacgacagaactt
cctgatgacgtctctgtcgtaacgctggcaactgcgcatcctgctaaatttccggatgct
gtggctcgtattacgggtaaaaatgcgcccttgccgcatcggttagctgatctttacagc
cgtgaagaacggtatgttgaattacctgcctcacgtcagactattcaggcttatatcgat
ggtgggtgcaaactttga

DBGET integrated database retrieval system