KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1229Help
Entry
Zymop_1229        CDS       T01556                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00260  Glycine, serine and threonine metabolism
zmp00750  Vitamin B6 metabolism
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01120  Microbial metabolism in diverse environments
zmp01230  Biosynthesis of amino acids
Module
zmp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Zymop_1229
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Zymop_1229
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Zymop_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEI38123
UniProt: F8EUA2
Position
1439048..1440445
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPESWPQFSREEIAALAGLSYVDTAVAVMR
PFVAGVLDDQALKNLCEAAYSQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLAGSEGQDLTIVGATSGDTGSAAISAVAGRAGVRIIMLHPNGRVSEVQRRQMTT
VLDDNVFNVAIDGSFDDAQAIVKAMFNDTEFRKRHRLGAVNSINWARLMAQIVYYFYSAV
RLGAPDRKVAFSVPTGNFGDVFAGYVASQMGLPIERLIVATNINDILYRALSAGDYSVGS
VTPTDAPSMDIQISSNFERLLFDLHGRDAHALADTMKTFEQSRAIRLSEAMRQQAAALFS
SSRIDPDGMAAAMRWASEKAGQVIDPHTAIGLAAARTTELPDDVSVVTLATAHPAKFPDA
VARITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDGGCKL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaagaggcgcggcagccgcgcaggatttcaaaggcgttactcta
accggtcttgcctctgatggtggtctttatgtgccggaaagctggccgcaattcagccgt
gaagagatcgctgctctggctggtttatcctatgtggatactgcggttgcagttatgcgg
ccgttcgtcgccggtgtgcttgacgatcaggctttaaaaaatctgtgcgaagccgcttat
agtcaatttaatcatgcagccgttacaccgcttgttcaactggatgaacggcattttctg
cttgaattattccatgggccgactttggcttttaaagatgtcgctttacaactgctgggt
catttgtttgaaaaatttttggccggtagcgaaggacaggatctgacgattgttggtgct
acttcaggcgatacggggtcggcggctatttctgctgtagcaggccgtgccggtgtccga
atcattatgctccatcctaatggtcgtgtttctgaagtgcagcgtcgtcaaatgacgacg
gttcttgatgataatgtctttaatgtcgccattgatggcagctttgatgatgcgcaagct
atcgttaaagccatgtttaatgataccgaattcagaaaacgccatcgtttaggggcggta
aactcgatcaactgggcgcgccttatggcgcaaattgtttactatttttattcagctgtt
cgtcttggcgcacctgatcgcaaagttgctttctcggtacctacgggtaatttcggggat
gtctttgcgggttatgttgccagccagatgggcttacctattgaacgcttgatcgttgca
actaacatcaatgatattctttatcgcgcgttgtcagcgggggattattctgtaggcagt
gtcaccccaacagatgcaccctcaatggatattcagatcagctctaattttgaaagattg
ctttttgatcttcatggccgcgatgcacatgcgctagcagatactatgaaaacctttgag
cagagccgtgctatccgtctttcggaggctatgcgccagcaagcggctgcgttattcagc
agcagccggatagatcctgatggtatggcagcggccatgcgttgggcttctgaaaaagca
ggacaggttatagatccccatacagcgattggtctggcggctgcacggacgacagaactt
cctgatgacgtctctgtcgtaacgctggcaactgcgcatcctgctaaatttccggatgct
gtggctcgtattacgggtaaaaatgcgcccttgccgcatcggttagctgatctttacagc
cgtgaagaacggtatgttgaattacctgcctcacgtcagactattcaggcttatatcgat
ggtgggtgcaaactttga

DBGET integrated database retrieval system