KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1240Help
Entry
Zymop_1240        CDS       T01556                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00860  Porphyrin and chlorophyll metabolism
zmp01100  Metabolic pathways
zmp01110  Biosynthesis of secondary metabolites
zmp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Zymop_1240
Enzymes [BR:zmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Zymop_1240
Exosome [BR:zmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Zymop_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEI38134
UniProt: F8EUB3
Position
complement(1452297..1453298)
Genome map
AA seq 333 aa AA seqDB search
MSLISTSYPATRLRRVRASAWSRNLHSENVLTPADFIWPLFVTSGMGVQEPVHSMPGVFR
WSVDLIVEQAKLAYSLGIPCLALFPNTDMSKRSEDGKEAWNSDNLMCQAIRAIKDAVPEI
GLLTDVALDPYTSHGHDGIVDEQGYVLNDETKDLLIKQARVQAEAGADIIAPSDMMDGRV
SAIREMLESEGHRNVQIMSYAAKYASVFYNPFRDAVGSAGVFKADKKTYQMDPANSEEAL
REVAMDIAEGADSVMVKPGLPYLDILWRVKDTFKLPVFAYQVSGEYAMLEAAFAAGMLDK
DRAVLETLICFKRAGAAGVLTYHAVHAAKLLNG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgatctctactagctatccggcgacccgtttgcgtcgtgtccgtgcttcagcg
tggagccgtaatcttcactctgagaatgttttaacgccagcggatttcatctggccgtta
tttgtgacgagtggtatgggggttcaagaacctgtccactccatgccgggggtctttcgt
tggtctgttgatctgatcgttgaacaggcaaaactagcctatagtttaggtattccctgc
ctcgctttgttcccgaatacggatatgtcaaagcgcagtgaagatggaaaagaggcttgg
aactctgataatctgatgtgtcaggctattcgcgctattaaggatgccgtacccgaaatt
ggtttattaactgatgtagccttagatccttataccagtcatggacatgatggcattgtt
gatgagcaaggctatgttctgaacgatgaaaccaaagatcttctcattaagcaggctcgt
gttcaggccgaagctggtgcagatattattgcgccttccgatatgatggatggtcgtgtc
agtgctattcgtgaaatgttagaaagcgaagggcaccggaatgttcaaattatgtcttac
gcagcaaaatatgcgagcgtcttttataatcctttccgagatgcagtaggttcggcaggt
gtattcaaggctgataaaaaaacctatcagatggatcctgccaatagcgaagaagctttg
cgtgaagtcgctatggatattgccgaaggcgcagatagtgtcatggtaaaaccgggtttg
ccttatcttgatattttatggcgggtgaaggataccttcaaattgcccgtttttgcctat
caggtatctggtgaatacgccatgttggaagctgcttttgcagcgggtatgttggataaa
gatcgcgcggttttggaaacgcttatctgctttaaacgtgctggagcagcgggcgtttta
acctatcacgcggttcatgctgcaaagcttctgaatggttaa

DBGET integrated database retrieval system