KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1468Help
Entry
Zymop_1468        CDS       T01556                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Zymop_1468
Enzymes [BR:zmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Zymop_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702639..1703190
Genome map
AA seq 183 aa AA seqDB search
MLYALALGSNRWHGRYGAPKAVIDAAIADLSAQGLTIKAQATIFETQAVGPAGRRFANTA
IIVQTTLLPLSLLALCKKTEQLFGRRAGRRWGARVLDIDILLWEKGRWPQKKQPLLRYRP
GLTSNKPPALWPTLHIPHLEISRRDFVLKPLTEIAGNWRVFEKNRFFTVKQLYFRYKCLT
PKQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttatacgcgctcgcattagggtctaatcggtggcatggccgctatggagcaccaaaa
gcggttatagacgccgctattgccgatttaagcgcccaagggcttactatcaaagcacaa
gccactatctttgaaacacaggctgtagggccagcagggcgacgtttcgccaatacggct
attattgttcaaactacgttgttgcccctatctttattggcgctttgtaaaaaaacggaa
cagctctttggaagacgggcagggcggcgatggggcgcccgtgttcttgatattgatatt
ctgctatgggaaaaagggcgttggccacaaaaaaaacaacctctattacggtatcgcccc
ggcctaacgtcgaataaaccgcctgccttatggccaacactgcatattccccatctagaa
attagccgccgtgattttgtgctaaaacctttaaccgagatagctggaaattggcgtgtt
tttgaaaaaaataggttttttaccgttaaacagctttattttcgttataagtgcttgacc
cctaagcaataa

DBGET integrated database retrieval system