KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_1481Help
Entry
Zymop_1481        CDS       T01556                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
zmp00300  Lysine biosynthesis
zmp01100  Metabolic pathways
zmp01120  Microbial metabolism in diverse environments
zmp01230  Biosynthesis of amino acids
Module
zmp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Zymop_1481
Enzymes [BR:zmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Zymop_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEI38371
UniProt: F8EVN4
Position
complement(1720093..1721223)
Genome map
AA seq 376 aa AA seqDB search
MTAAPDAVELAARLIACKSVTPTDDGAMSVMGDALKAAGFKVHLLTQGQAPDGPVTNLIA
FRGEGHPHLAFAGHSDVVPAGQGWSSDPFTPTLKDGYLVGRGAVDMKSSVAAFIAAAARY
RHHKGTLSFLITGDEEGPATYGTPAIIAWLLEHDIKLDYCVVGEPTSIDTLGDTIKNGRR
GSVNMWIEVPGIQGHVAYPDRAKNPIPILARIIEDLENWIIDEGDQWFQPSNLEITAIEC
DNKATNVIPSIAKAQLNIRFNALQKGAQLIETVRNRVNAIAPDARLKATISGEAFVTEEG
VLTKKVSAAVAKNTGITPTLSTSGGTSDARFLTHICPVIEFGLVNATMHKVDEQAAVADI
QQLSRIDEDIIKAFLG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgcccctgacgctgttgaacttgctgcccgcttgattgcctgcaaatcagta
acgccgactgatgatggtgccatgagcgtgatgggcgacgctttgaaagccgctggtttc
aaagttcatttattaacgcaaggtcaagcccctgatggccctgtcaccaatttaatagct
tttcggggcgaaggtcatccccatttagcctttgcagggcatagtgatgtagtcccagcc
ggtcagggatggtcttcagatccctttacacccaccttaaaggacggctatttggtcgga
cgtggggcagtcgatatgaaaagttctgtcgcggcctttattgccgccgcagcccgctat
cgccatcacaaaggtaccttgtcttttttgattacaggcgacgaggaaggccccgccacc
tatggcacaccggccatcattgcatggttgctggaacatgatattaaattggattactgt
gttgtgggcgagcctacctctattgataccctaggggatactatcaaaaatggtcggcgc
ggttcagttaatatgtggatcgaggtaccaggcatacaaggccatgtcgcctatcccgac
cgagcaaaaaacccgattccgattttggcgcgcataatcgaggatttagaaaactggatt
attgatgaaggggaccaatggtttcagccttccaatctcgaaattacagccattgaatgc
gataacaaggcaacgaatgttatcccttctatagcaaaagcccaacttaatattcgcttt
aatgcattacaaaaaggtgctcagttaatagaaactgtccgaaatcgggtgaacgctatt
gcgcctgatgcccgattgaaggctactatttctggggaagcctttgttacagaagaaggg
gtccttactaaaaaagtaagtgctgcagtagctaaaaataccggaatcacccctaccctt
tctacaagcggcgggacgtcggatgcccgtttcttgacgcatatttgtccagtaattgaa
tttggtttagtcaatgctacgatgcataaggtcgatgagcaagccgcagtagccgatatt
caacaattaagccgtattgatgaggatattattaaagcttttttgggctaa

DBGET integrated database retrieval system