KEGG   Zunongwangia profunda: ZPR_0589Help
Entry
ZPR_0589          CDS       T01216                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zpr  Zunongwangia profunda
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZPR_0589
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ZPR_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622257..622838
Genome map
AA seq 193 aa AA seqDB search
MIHHLKGKLVEKNPTYVVVDCNGVGYFVHISLNTFSKIKDEEQIAIFTHLQVKEDSHTLF
GFQEKSEREIFRLLISVSGIGASTARTMLSSLDPTQIRDAIASGDVATIQSIKGIGAKTA
QRVILDLKDKIVKIFGIDEVFVEQSNTIKEEALSALETLGYARKQADKVLNKLIKEIEDP
TVETLIKLALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcacttaaagggcaaactggtagagaagaatcctacctatgttgttgtagat
tgtaatggcgtgggttattttgtccatatttcgcttaatactttttcaaagataaaggac
gaagagcagattgctatattcacccatttgcaggtgaaggaagattctcatacccttttt
ggatttcaggaaaaatctgaaagggaaatctttaggcttcttatttccgtaagtggtata
ggggccagtaccgccagaacaatgctttcatctttagatcctactcaaattagggacgct
attgcatctggagacgtggcaaccatacaaagcataaaagggataggagcaaaaacggca
cagcgcgttattttagacttaaaagataagattgttaaaatctttggtatagacgaggtt
tttgtagaacagagcaatacaattaaagaagaagcgttatctgcattagagacgttgggc
tacgcccgtaaacaggcagataaagttctaaataagctaataaaagagatagaagatcct
actgtagagactctcattaaattggcgctaaaaaatttgtag

DBGET integrated database retrieval system