KEGG   Zunongwangia profunda: ZPR_0632Help
Entry
ZPR_0632          CDS       T01216                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00010  Glycolysis / Gluconeogenesis
zpr00020  Citrate cycle (TCA cycle)
zpr00620  Pyruvate metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
Module
zpr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_0632
   00020 Citrate cycle (TCA cycle)
    ZPR_0632
   00620 Pyruvate metabolism
    ZPR_0632
Enzymes [BR:zpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ZPR_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding TFIIF_alpha RnfC_N NQRA LAP1C
Motif
Other DBs
NCBI-ProteinID: ADF50989
UniProt: D5BFP5
Position
674772..676208
Genome map
AA seq 478 aa AA seqDB search
MAKEIKVPQIGDGVESATVSEVLVAEGDKIEKDQSVIAVESDKASVEVPSSAAGTIKEIK
ISEGDEVEVGQVIILLEESDDDDDDETEEDNGEASEEEKEKENTSEEENENEDEDSGEKQ
SGKKKKKIKEENPEDNDEEPEEDDADENKDEKKSSKKDESEADKTSEEKENKKSGESSGE
SSTGAGIQASPGTRRLARELGVDLTELAEEISGRVSEKDVKEFAKKDSQKSTRSASISLP
DFEKWGSVERKPLNNIRKATAKNVTASWQSVPHVFQFDEADITDIQQYLEVNQDKAEKAG
GKLTITALLTKIVASALVRFPKFNASIDMENEEMILKNYVNIGIAVATEKGLLVPVIKDA
DKKSIIEIATELTNIAEKARDGKLSKEDMEGANFSISNLGGIGGTNFTPIVPAFQVAILG
ISRSAKKPVYIDDEFKPREILPLSLSYDHRLIDGADGAAFINWITQALEDPYKALLGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaattaaagttccgcaaataggtgacggagtagaatctgcaacagtttct
gaggtattagttgctgaaggtgataaaatcgaaaaagatcagagtgttattgctgtagaa
agtgataaagcttcagtagaagttccaagttcggccgcggggactataaaagaaataaag
atcagtgaaggtgatgaggttgaagttggtcaagtcattattcttttggaagaatctgat
gatgatgatgatgatgaaactgaggaagataacggggaagcttcagaagaagagaaggaa
aaagaaaatacttccgaagaagaaaatgaaaatgaagatgaagattctggagaaaaacag
tctggaaagaaaaagaaaaaaataaaagaggaaaatccggaagataacgacgaagagcct
gaggaagatgatgcggatgaaaataaggatgagaaaaaatcatctaaaaaggatgaatct
gaggctgacaaaacttctgaagaaaaagaaaataagaagtctggagaatcttcaggagag
tcatctaccggagccggaattcaggcttcgccaggtactcgtcgcttagcaagagaactc
ggtgtagatcttactgaactggcagaagagatttcggggagagtttcagaaaaagacgtc
aaagaatttgctaaaaaagatagtcagaaatcaacaagatcagccagtatttctttacct
gattttgaaaaatggggcagtgtggagcgtaagccattaaataatattcgaaaagcgacg
gcgaaaaatgtgactgcttcctggcaatcggttccgcatgttttccagtttgatgaagcc
gatattactgatattcagcaatatttagaggtgaatcaggataaagccgaaaaagccggt
gggaaattaacgattaccgcattattgactaaaatcgttgcgagtgcattagttcgattt
ccaaagtttaacgccagtatagatatggaaaacgaagagatgattctgaagaattatgta
aatatcgggattgcagtagctacagaaaaaggacttttagtgccagttattaaagatgcc
gataagaaaagtattatagaaattgctacggaattaactaatatcgctgaaaaagccagg
gatggaaaattaagcaaggaagatatggaaggggctaatttctctatttctaatcttggc
ggaattggaggtactaattttacaccgatcgttcctgcattccaagtggctattttggga
atttcacgttcggctaaaaaaccggtgtatatcgacgatgaatttaagccaagagaaatc
ttaccattaagcttatcctacgatcatcgtttaatcgatggcgccgatggcgccgcgttt
ataaattggatcacacaggcgctggaagatccttacaaagctttgcttggggcgtaa

DBGET integrated database retrieval system