KEGG   Zunongwangia profunda: ZPR_0754Help
Entry
ZPR_0754          CDS       T01216                                 

Definition
family 10 glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
zpr  Zunongwangia profunda
Brite
Enzymes [BR:zpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     ZPR_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817662..818822
Genome map
AA seq 386 aa AA seqDB search
MKNLFYFFAILLFFWNCKPNRTQSDTAMSDTATFETEKPRKLKDALNGKFLMGTALNVRQ
IEGFNPAEMEIVKTHFNSIVAENCMKSGRLVPQKDHYNFDTADNFVKFGEDNNMVIHGHT
LVWHSQTPRWFFKDKAGNEIDKEELSRRIKDHINTVVNRYKGRIKTWDVVNEAVLDDGSL
RKSKFYNLLGEDFIKIAFETAHKADPDAELYYNDYSTSIPKKREGIVRMIKKLQAQGVPI
HGVGMQGHVGLDYPELEEFEKTIEAFSALGLKVAVTEFDITVLPSPWENQGAEISANFEY
KEQMNPYPDKLPDSVNTAFNARCLDFFKLFLKHQDKLEKITMWGVNDDNSWRNNWPVGGR
TDYPLLFDRKNRPKPIVNHLVDLATQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctattttacttttttgctatcctattgtttttttggaactgcaagccaaat
cggacgcaatctgataccgcaatgtctgataccgcaacatttgaaactgaaaaacctcga
aagcttaaagatgctttaaatggcaaatttttaatgggtactgctcttaatgtacgccaa
atagaaggttttaatccagccgaaatggagattgtgaaaacgcattttaattccattgtt
gcagaaaactgcatgaaaagtgggcgtcttgtgcctcaaaaagatcattataattttgat
actgcagataattttgtaaagtttggagaagataataatatggtgattcatgggcatacc
ctggtatggcattctcaaaccccacgctggttctttaaagataaagcaggtaatgaaatc
gataaggaagaacttagcaggcgtatcaaagatcatatcaacacggtggtaaaccgttat
aaagggcgcataaaaacctgggatgtagtcaacgaagcagtcctggatgatggctcttta
cgtaaaagcaagttctacaatttactgggcgaagattttataaaaatagcctttgaaaca
gctcataaggcagatccggatgctgaactttattataacgattattcaacttctattcct
aaaaaacgagaaggcatcgtacggatgattaaaaagctacaggcacagggtgtacctatt
catggtgtaggaatgcaggggcatgtaggcttggactatccagaactggaagaatttgaa
aagacgattgaagctttttcggctcttggattaaaagtagcggtaaccgaatttgatatt
acggtgctgccttcaccctgggaaaatcagggggcagaaatttcagcaaattttgaatat
aaggaacaaatgaatccctatcctgataaacttcccgattcggtaaatactgcttttaac
gcgagatgcctcgatttttttaaactttttttaaagcaccaggataaattggagaagatc
acgatgtggggcgttaatgatgataattcctggagaaacaactggcctgtaggcggacgt
accgactatccgttattatttgatcgtaaaaacaggcctaaaccaatagttaatcatctt
gtagatttagctacacaataa

DBGET integrated database retrieval system