KEGG   Zunongwangia profunda: ZPR_0767Help
Entry
ZPR_0767          CDS       T01216                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
zpr  Zunongwangia profunda
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:zpr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
835768..837261
Genome map
AA seq 497 aa AA seqDB search
MDQYMLALDQGTTSSRAILFDKKGSIVSVAQKEFTQHFPKPGWVEHDPSEIWSTQAGVAA
EATTKHGMNGKNIAGIGITNQRETVVVWDKNTGDPVYNAIVWQDKRTSEYCDELKENGKA
ELIKKKTGLVIDSYFSGTKVKWILDNVEGAREKAEAGDLIMGTIDTWLIWNFTKGELHVT
DVTNACRTLFFNINTMEWDDELLEIFDVPKSMLPEVKDSSEVYGHTKTTVFASKIPIAGI
AGDQMAALFGQMCTKKGMVKNTYGTGCFMLMNIGEEPIVSENNLLTSVAWRINGKTEYCL
EGSIFIAGAVVQWLRDGLGIIKRSSDVENLAASVDSTEGVYFIPAFSGLGAPHWNQKAQG
TMFGITRGTTDAHIARASLEAIAYQTMDILKAMQADSGIDIKQLRVDGGASVNDMLMQFQ
SDVLNTETVRPEITETTALGAAYLAGLAVGYWDSMEEIEEIWKVEKEFQPTENQDDVKDG
IKGWYKAVKALEQWTKL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtatatgttagctctggatcagggcactacgagctcccgcgcaatccttttc
gacaaaaagggaagtattgtttcggtggcccaaaaagaatttacacagcattttccaaaa
ccgggatgggtagagcacgacccaagtgaaatttggtctacacaggccggggtagccgca
gaggccaccacaaagcatgggatgaatggaaaaaatattgcaggaattggtattacaaat
caacgcgaaaccgttgtagtttgggataaaaatactggggatcctgtgtataatgctatt
gtatggcaggataaaagaacctcggagtattgtgatgaattaaaggaaaatggtaaagcc
gagctaattaagaaaaaaacgggactggtaatcgattcttacttttctggaaccaaagta
aaatggattttggacaatgtggaaggagctcgtgaaaaagcagaagctggcgacctgatt
atgggaactattgatacctggctaatctggaattttacaaaaggagaattacacgttacc
gatgttacgaatgcttgccgtacactgttctttaatattaatacaatggaatgggacgac
gaacttttggaaatttttgatgtgccaaaaagtatgttaccagaagttaaagattccagc
gaagtttacgggcataccaaaaccaccgtttttgcctcaaaaatccctattgccggaata
gctggtgatcagatggccgctttatttggtcagatgtgtactaaaaaaggaatggttaaa
aacacctatggcaccggatgctttatgttaatgaatataggggaagaaccgatagtttca
gaaaataaccttttaacttctgtagcctggagaattaatggaaaaactgaatattgttta
gagggatctatttttatcgccggtgcagttgtacaatggttgcgcgatggactggggatt
attaaaagatcatcagatgttgaaaatttagcagcttctgtagattctactgagggggtt
tattttattccggcattttcaggattgggtgctccacattggaaccaaaaagcacaagga
accatgttcggtatcaccaggggtaccacagatgctcacatcgcaagagcttctttagag
gcaatagcataccagaccatggatattttaaaagcaatgcaggccgatagtggtattgat
ataaaacaacttagggtagatggcggagcatctgtaaatgatatgcttatgcaatttcaa
agtgatgttttgaatacagagaccgtacgtcctgaaattacagagactaccgcactggga
gctgcatatcttgctggtctggccgtaggatattgggatagtatggaagaaattgaagaa
atctggaaagtagaaaaagaatttcagcccacagaaaatcaagatgacgttaaagatggt
atcaaaggatggtacaaggcggtaaaggctttagaacaatggacaaaactttaa

DBGET integrated database retrieval system