KEGG   Zunongwangia profunda: ZPR_0829Help
Entry
ZPR_0829          CDS       T01216                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zpr  Zunongwangia profunda
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZPR_0829
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZPR_0829
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZPR_0829
Enzymes [BR:zpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZPR_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(895342..896088)
Genome map
AA seq 248 aa AA seqDB search
MKEDKKLLSIYFTSGYPEIEDTVHIIKNLEKSGVDFIEIGLPFSDPLADGPTIQESSTIA
LKNGMTTNKLFEQLKDIRSEVSIPLIIMGYFNPILQFGVEKFCAKCEEVGIDGLIIPDLP
VDVYKDEYKVIFEKHRLKNIFLITPQTSEERIRFIDKVSDGFIYMVSTASVTGSTKGFGD
ETKAYFKRISEMKLRNPQVVGFGISDEATFNDATKYAKGAIIGSAFIKHLNKNGIGNIQD
FVKSVRPV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagacaaaaaacttctttctatatattttacttcaggatatcctgaaattgaa
gacacggtacatattattaaaaaccttgaaaaaagtggggtcgattttattgaaatcggg
cttccgtttagtgaccctttagctgatggtcctaccattcaggaaagttctacaattgca
ttaaaaaacggaatgaccaccaacaagctctttgaacaattaaaagatattcgttcggaa
gtttcgattccactaattattatgggctattttaatcccattcttcaatttggcgtagaa
aaattttgcgcaaaatgtgaagaagttggtatcgacgggctcattattccggatcttcct
gtagacgtttataaggatgaatataaagtgatattcgaaaaacatcgattaaagaatata
ttcctaatcacgccacaaacttcagaagaacgtattcgttttatagataaagtttccgac
ggatttatttatatggtaagtaccgctagcgttaccggaagcactaaaggttttggcgac
gaaaccaaagcatattttaaacgaatttcagaaatgaaacttagaaatccgcaagtggtt
ggatttggaattagtgatgaggctacgtttaatgatgctaccaaatatgctaaaggtgct
attattggtagtgcttttatcaagcatttaaataaaaatggcatagggaatattcaggat
tttgtaaaatcggttcgcccggtttaa

DBGET integrated database retrieval system