KEGG   Zunongwangia profunda: ZPR_0982Help
Entry
ZPR_0982          CDS       T01216                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zpr  Zunongwangia profunda
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_0982
   01230 Biosynthesis of amino acids
    ZPR_0982
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_0982
   00051 Fructose and mannose metabolism
    ZPR_0982
   00562 Inositol phosphate metabolism
    ZPR_0982
Enzymes [BR:zpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZPR_0982
Exosome [BR:zpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZPR_0982
  Exosomal proteins of bladder cancer cells
   ZPR_0982
  Exosomal proteins of melanoma cells
   ZPR_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070943..1071695
Genome map
AA seq 250 aa AA seqDB search
MRKNIVAGNWKMNNDLAQTQELIADLKKQISAAPAATVMIAPTYTNLYPAFEALKNTPVI
VAAQNMHQNASGAFTGEISAAMLKSVGVETVILGHSERRAYFKESNELLAEKVNTALEND
MTVIFCFGEELEDRKADKHFDLVESQLKESLYHLSKESWKNIILAYEPVWAIGTGETASP
EQAQEMHAFIRKSIADAYGSEIAEEVSILYGGSVKPANAKEIFAKEDVDGGLIGGASLKA
EDFLAIVNAF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatattgtagccggaaactggaaaatgaataacgacctggcacaaacccag
gaactaattgctgaccttaagaagcaaatttcggcagccccagcagcaacggtaatgata
gcaccaacctatacgaatttatatcctgcttttgaggctttaaaaaatacccccgttatc
gtagcagcacaaaatatgcatcaaaatgcaagcggagcttttaccggtgaaatctctgca
gcaatgctaaaaagtgtaggcgtagaaacagtgatcttaggacacagtgaaagacgtgct
tattttaaagaatctaatgagcttcttgctgaaaaagtaaataccgctttagaaaatgat
atgacggtaattttttgttttggagaagaattagaggaccgtaaagccgataagcatttt
gatttagttgaaagtcagcttaaagaaagtttataccacctatctaaagagagctggaaa
aatataatccttgcttatgagccagtttgggcgattggtacaggagaaactgcatcgcca
gagcaagcgcaggaaatgcatgcttttataagaaaaagtattgcggatgcttacggaagc
gaaattgcagaagaggtttctattctttatggaggtagtgtgaagccagctaacgcgaaa
gaaatcttcgctaaagaagatgtagatggtggtctaattggtggagctagtcttaaagca
gaagactttttagcaatcgtgaacgcattttaa

DBGET integrated database retrieval system