KEGG   Zunongwangia profunda: ZPR_0982Help
Entry
ZPR_0982          CDS       T01216                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zpr  Zunongwangia profunda
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_0982
   01230 Biosynthesis of amino acids
    ZPR_0982
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_0982
   00051 Fructose and mannose metabolism
    ZPR_0982
   00562 Inositol phosphate metabolism
    ZPR_0982
Enzymes [BR:zpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZPR_0982
Exosome [BR:zpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZPR_0982
  Exosomal proteins of bladder cancer cells
   ZPR_0982
  Exosomal proteins of melanoma cells
   ZPR_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070943..1071695
Genome map
AA seq 250 aa AA seqDB search
MRKNIVAGNWKMNNDLAQTQELIADLKKQISAAPAATVMIAPTYTNLYPAFEALKNTPVI
VAAQNMHQNASGAFTGEISAAMLKSVGVETVILGHSERRAYFKESNELLAEKVNTALEND
MTVIFCFGEELEDRKADKHFDLVESQLKESLYHLSKESWKNIILAYEPVWAIGTGETASP
EQAQEMHAFIRKSIADAYGSEIAEEVSILYGGSVKPANAKEIFAKEDVDGGLIGGASLKA
EDFLAIVNAF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatattgtagccggaaactggaaaatgaataacgacctggcacaaacccag
gaactaattgctgaccttaagaagcaaatttcggcagccccagcagcaacggtaatgata
gcaccaacctatacgaatttatatcctgcttttgaggctttaaaaaatacccccgttatc
gtagcagcacaaaatatgcatcaaaatgcaagcggagcttttaccggtgaaatctctgca
gcaatgctaaaaagtgtaggcgtagaaacagtgatcttaggacacagtgaaagacgtgct
tattttaaagaatctaatgagcttcttgctgaaaaagtaaataccgctttagaaaatgat
atgacggtaattttttgttttggagaagaattagaggaccgtaaagccgataagcatttt
gatttagttgaaagtcagcttaaagaaagtttataccacctatctaaagagagctggaaa
aatataatccttgcttatgagccagtttgggcgattggtacaggagaaactgcatcgcca
gagcaagcgcaggaaatgcatgcttttataagaaaaagtattgcggatgcttacggaagc
gaaattgcagaagaggtttctattctttatggaggtagtgtgaagccagctaacgcgaaa
gaaatcttcgctaaagaagatgtagatggtggtctaattggtggagctagtcttaaagca
gaagactttttagcaatcgtgaacgcattttaa

DBGET integrated database retrieval system