KEGG   Zunongwangia profunda: ZPR_1233Help
Entry
ZPR_1233          CDS       T01216                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
zpr  Zunongwangia profunda
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZPR_1233
DNA repair and recombination proteins [BR:zpr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ZPR_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346187..1346804
Genome map
AA seq 205 aa AA seqDB search
MDFSSKLLEQAVDQMSQLPGIGKRTALRLVLHLLRQPETQTEQLTKALSKLRAEIKRCRN
CYNISDTELCDICANPSRQEDLVCIVEDVRDVMAIENTGQYRGMYHVLGGKISPMDGIGP
SQLTIKPLIEKVRDGKIQEIIFALSSTMEGDTTNFYIYKQLEGSGVKTSTIARGISVGDE
LEYADEVTLGRSITNRIPFENSLKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcttcgaaattattggagcaggctgtagaccaaatgtcgcagttgcccggt
ataggaaaacgtaccgcgcttagattggttttgcatctattaagacaacctgaaacgcaa
accgaacaacttaccaaagcactttctaagctacgggccgaaataaaaagatgtagaaat
tgttataatattagcgataccgagctttgtgatatttgtgcaaatccttcccgccaggaa
gatcttgtttgtattgtagaagatgtacgcgatgtgatggcgatagaaaatacagggcaa
tatcgtggtatgtaccatgttttaggagggaagattagtcctatggatggaataggccct
tcccagcttaccattaagcctttaatcgaaaaagtgagagatggtaaaattcaggaaatt
atttttgcgctaagcagcactatggaaggggatacaactaatttttatatttataaacaa
ctagagggtagcggcgttaaaacatcgaccattgccaggggaattagcgttggtgatgaa
ttagaatatgctgatgaggtaactttaggaagaagtattaccaatcgtataccttttgaa
aatagccttaaaagttaa

DBGET integrated database retrieval system