KEGG   Zunongwangia profunda: ZPR_1235Help
Entry
ZPR_1235          CDS       T01216                                 

Definition
lipoamide acyltransferase component of 2-oxoacid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zpr  Zunongwangia profunda
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_1235
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZPR_1235
  Amino acid metabolism
   00310 Lysine degradation
    ZPR_1235
Enzymes [BR:zpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ZPR_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346989..1348350
Genome map
AA seq 453 aa AA seqDB search
MAKFELKLPKMGESVAEATITSWLKEVGDTIEADEPVLEIATDKVDSEVPSEVDGKLIEI
LFEADDVVEVGQTIAIIETDGDVEQEDDLDLDLEDDEDEDEDEDEESTTETEQHVAEAEA
AVETAKETAGGSSDYSESDRFYSPLVKNIAKEENISLKELETVKGTGKNGRVTKDDILAY
VENRSSKSEENSDAHKAASKPDHLEPAFKNQESTVSSGEDEIIEMSRMGKMISKHMIDSV
QTSAHVQSFIEVDVTNIWNWRNKHKEAFQKKEGEKLTFTPIFMEAVAKAIRDFPLINISV
DGDNIIKKKNINLGMAAALPDGNLIVPVIKNADRLNLVGMAKAVNDLANRARQNKLKPDD
IQGGTYTVTNVGTFGSIMGTPIINQPQVGILALGAIRKMPAVIETPEGDFIGIRYKMILS
HSYDHRVVNGALGGQFVQRVAQYLEGFDKNRVL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaactgaaattacctaaaatgggagaaagtgttgctgaggcaaccata
accagctggttaaaagaagtaggcgataccattgaagcagacgaaccggtacttgaaatt
gctacagataaagtagatagtgaagttcccagtgaagtagatggcaaacttatagaaata
ctttttgaagctgatgatgtagttgaagtaggccaaactattgctattattgagactgac
ggtgatgtggagcaggaagatgatcttgatctcgatttggaggacgatgaagatgaagat
gaagatgaagatgaagaaagtactacagagacagaacaacatgtagctgaagctgaagct
gccgttgaaactgccaaggagactgctggaggtagtagcgactattcagagtcagatcgt
ttttattctcctttagtaaaaaatatcgccaaagaagaaaatattagtcttaaagaatta
gaaactgtcaaaggaaccggtaaaaacggtcgggtaaccaaagacgatattttagcttat
gttgaaaatcgcagcagtaagtcagaagaaaattcagatgctcataaggcagcttcgaaa
ccagatcatttagagcccgcttttaaaaatcaggaaagtacggtgagttcaggagaagat
gagattatcgaaatgagccgtatgggtaaaatgataagtaagcatatgatcgatagtgtg
cagacttcggctcatgtacaatcttttatagaagtagatgtaactaatatttggaactgg
agaaacaaacataaagaggcatttcagaaaaaagaaggtgagaaattaacatttacacca
atatttatggaagccgtagcgaaagccattcgtgattttccactaatcaatatttccgta
gacggggataatataattaaaaagaagaatatcaatcttggtatggcggcagcgcttccc
gatggtaatcttattgtaccggtaattaaaaatgcagatcgattaaaccttgtaggcatg
gccaaagcggtaaacgatttggcgaatagggcacgacagaataaactgaagccagacgat
atacaggggggtacttatacggtaaccaatgttggaacatttggaagtattatgggaaca
ccaataattaatcagccccaggtaggtatcctggccttgggagctattcgaaaaatgcct
gcggttatcgaaactccagaaggtgattttatcggtattcgatataaaatgattttatcg
catagctatgatcaccgggtggtgaatggagcgcttggtggacagtttgtgcagcgggta
gcacaatatttagaaggattcgacaaaaatagagtattataa

DBGET integrated database retrieval system