KEGG   Zunongwangia profunda: ZPR_1235Help
Entry
ZPR_1235          CDS       T01216                                 

Definition
lipoamide acyltransferase component of 2-oxoacid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zpr  Zunongwangia profunda
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_1235
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZPR_1235
  Amino acid metabolism
   00310 Lysine degradation
    ZPR_1235
Enzymes [BR:zpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ZPR_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346989..1348350
Genome map
AA seq 453 aa AA seqDB search
MAKFELKLPKMGESVAEATITSWLKEVGDTIEADEPVLEIATDKVDSEVPSEVDGKLIEI
LFEADDVVEVGQTIAIIETDGDVEQEDDLDLDLEDDEDEDEDEDEESTTETEQHVAEAEA
AVETAKETAGGSSDYSESDRFYSPLVKNIAKEENISLKELETVKGTGKNGRVTKDDILAY
VENRSSKSEENSDAHKAASKPDHLEPAFKNQESTVSSGEDEIIEMSRMGKMISKHMIDSV
QTSAHVQSFIEVDVTNIWNWRNKHKEAFQKKEGEKLTFTPIFMEAVAKAIRDFPLINISV
DGDNIIKKKNINLGMAAALPDGNLIVPVIKNADRLNLVGMAKAVNDLANRARQNKLKPDD
IQGGTYTVTNVGTFGSIMGTPIINQPQVGILALGAIRKMPAVIETPEGDFIGIRYKMILS
HSYDHRVVNGALGGQFVQRVAQYLEGFDKNRVL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaactgaaattacctaaaatgggagaaagtgttgctgaggcaaccata
accagctggttaaaagaagtaggcgataccattgaagcagacgaaccggtacttgaaatt
gctacagataaagtagatagtgaagttcccagtgaagtagatggcaaacttatagaaata
ctttttgaagctgatgatgtagttgaagtaggccaaactattgctattattgagactgac
ggtgatgtggagcaggaagatgatcttgatctcgatttggaggacgatgaagatgaagat
gaagatgaagatgaagaaagtactacagagacagaacaacatgtagctgaagctgaagct
gccgttgaaactgccaaggagactgctggaggtagtagcgactattcagagtcagatcgt
ttttattctcctttagtaaaaaatatcgccaaagaagaaaatattagtcttaaagaatta
gaaactgtcaaaggaaccggtaaaaacggtcgggtaaccaaagacgatattttagcttat
gttgaaaatcgcagcagtaagtcagaagaaaattcagatgctcataaggcagcttcgaaa
ccagatcatttagagcccgcttttaaaaatcaggaaagtacggtgagttcaggagaagat
gagattatcgaaatgagccgtatgggtaaaatgataagtaagcatatgatcgatagtgtg
cagacttcggctcatgtacaatcttttatagaagtagatgtaactaatatttggaactgg
agaaacaaacataaagaggcatttcagaaaaaagaaggtgagaaattaacatttacacca
atatttatggaagccgtagcgaaagccattcgtgattttccactaatcaatatttccgta
gacggggataatataattaaaaagaagaatatcaatcttggtatggcggcagcgcttccc
gatggtaatcttattgtaccggtaattaaaaatgcagatcgattaaaccttgtaggcatg
gccaaagcggtaaacgatttggcgaatagggcacgacagaataaactgaagccagacgat
atacaggggggtacttatacggtaaccaatgttggaacatttggaagtattatgggaaca
ccaataattaatcagccccaggtaggtatcctggccttgggagctattcgaaaaatgcct
gcggttatcgaaactccagaaggtgattttatcggtattcgatataaaatgattttatcg
catagctatgatcaccgggtggtgaatggagcgcttggtggacagtttgtgcagcgggta
gcacaatatttagaaggattcgacaaaaatagagtattataa

DBGET integrated database retrieval system