KEGG   Zunongwangia profunda: ZPR_1580Help
Entry
ZPR_1580          CDS       T01216                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zpr  Zunongwangia profunda
Brite
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ZPR_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697252..1698280
Genome map
AA seq 342 aa AA seqDB search
MLILLILGLYSCSDDEAEYISINRELDVNIPSNFPQIQYDLSANPPTEKGFELGKKLFYD
GRLSSNGFISCGFCHEQRFAFTHHGHQFSHGIDDLEGTRNAPAVQNMAFQKEFAWDGATS
HLDLFPIIPITNEVEMGETVSNVVSKLREDDEYQKLFTEAFDEGEVNNEYFFKALSQFMV
MMVSSNSTYDKYVRGEEGGEFTETEEYGYELFQQKCASCHTSDLFTDDAFRNNGLPPYPG
INDIGRAEVTGSTADNYKFKVPSLRNVAITAPYMHDGRFGSLASVLNFYDTGVQDSETLD
PILKQNNRLGIDLSEEEKQALIAFLNTLTDETFLNDERFAEY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgctgattctgttgattttaggcctctattcctgtagtgatgatgaagccgaatatatc
tcgatcaatagggaactggatgtcaatataccttcaaatttcccacagattcagtatgat
cttagtgccaatccaccaaccgaaaaaggatttgagttgggtaaaaaactgttctatgat
ggccgtctatcttcaaacggatttatctcttgcggattttgtcacgagcagcgctttgcg
tttacgcatcacgggcatcagtttagtcatggaatcgatgatttagaaggtacacgtaat
gcaccggcagttcaaaatatggcattccaaaaagagtttgcctgggatggtgcaacttcg
cacctggatttatttcctattatccccataaccaatgaagtagaaatgggagaaaccgta
tccaacgtggtttccaaattgcgcgaggatgacgaatatcaaaaattatttacagaagct
tttgatgagggtgaggtaaacaacgaatatttctttaaagctttatcacagtttatggtg
atgatggtctcttcaaactcaacctatgataaatatgtaaggggagaagaaggtggtgaa
tttactgaaactgaagaatatggttatgaattatttcagcaaaaatgtgcttcctgtcat
accagtgatttatttaccgatgatgcttttagaaataacggattgccgccttatcccggt
attaatgatattggtcgggccgaagtaaccggcagcacagccgataattataaatttaaa
gtacccagtttaagaaatgtggcgattaccgctccttatatgcatgatgggcgttttggt
agtttagcatcggtacttaatttttacgatactggtgtacaggattcagaaaccttagat
cctattttaaaacaaaataacaggttaggtatcgatttaagcgaggaagaaaagcaggct
ttaatagcctttttaaacaccctaaccgatgaaacttttttaaacgatgaacgatttgca
gaatattaa

DBGET integrated database retrieval system