KEGG   Zunongwangia profunda: ZPR_1590Help
Entry
ZPR_1590          CDS       T01216                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
zpr  Zunongwangia profunda
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ZPR_1590
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ZPR_1590
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ZPR_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1709680..1710225
Genome map
AA seq 181 aa AA seqDB search
MMMKKILLVLALIFGTTLIAQNNKTIYQFKVEDINGETFDFSSLKGKKIMIVNTASKCGF
TPQYAELQHIYEQYKYKDFVIVGFPSNDFGNQEPGSNEDISEFCQQNYGVEFPMMSKIKV
KGDEKHPLYQFLTEKAKNGFKDSEVKWNFQKYLIDQNGRVVAVKNSNVLPNDSEIVNWIQ
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaaaaaaatccttttggtgcttgcgttaatttttggtactactctgatagcc
caaaacaataaaacgatatatcaatttaaagttgaagatattaatggagaaacattcgat
ttcagttctctaaaaggtaaaaagataatgatcgttaacacggcaagtaaatgtggtttt
acaccgcagtatgccgaattacagcatatttacgaacaatataagtataaggattttgta
atcgtaggcttcccttccaacgattttggaaatcaagagccaggctccaatgaggatatc
tctgaattctgccagcagaattatggagtggaatttcctatgatgtcaaagattaaagtt
aagggagatgaaaagcatccattgtatcagtttttaaccgagaaagctaaaaacggattt
aaagattctgaagtgaaatggaatttccagaaatatttaatcgatcaaaatggcagagta
gtagccgtaaagaattctaatgtacttccaaacgactctgaaattgtaaattggattcag
gaatag

DBGET integrated database retrieval system