KEGG   Zunongwangia profunda: ZPR_1645Help
Entry
ZPR_1645          CDS       T01216                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
zpr  Zunongwangia profunda
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZPR_1645
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZPR_1645
   00640 Propanoate metabolism
    ZPR_1645
   00660 C5-Branched dibasic acid metabolism
    ZPR_1645
Enzymes [BR:zpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ZPR_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1773944..1775137
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKEILGSFGVRTQRGIVAQTAEEAVKAAKELTEQTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLKEVEQIAGEIIGMNLVTPQTSAEGKKVHQVYVAEDVYYPGDSEPEEYYMS
VLLNRATGRNMIMYSTEGGMDIETVAEETPHLIFTEEIDPATGLLPFQARKIAFNLGLSG
TAFKEMTKFVTSLYTAFDKSDSSLFEINPVLKTSDDKILAVDAKVTLDDNALFRHKDYAE
MRDKREENPTEVEAKEVGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TADAKRVEEAFRLILKDEKVEAILVNIFGGIVRCDRVAQGIVDAYKNMGDAIKVPIIVRL
QGTNADVAKKLIDESGLAVSSAVQFKEAADKVQAVLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaaggaaaagagattctaggtagctttggagtacgtactcaa
agagggatcgtagcccaaactgcagaagaagctgtaaaagccgcaaaagaactaacagag
caaaccgggaccggatggcacgtaatcaaagcacaggttcatgcaggtggtcgtggtaaa
ggaggcggcgttaagcttgcaaaaaaccttaaagaagtagagcagattgccggagaaatc
atagggatgaatttggtaactcctcaaacctctgcggaaggtaaaaaagtgcaccaggta
tacgtagcagaagatgtttattacccaggagatagcgaaccagaagaatattatatgtcg
gttttattaaaccgtgcaacaggtcgcaatatgattatgtattctacggaaggtggaatg
gatattgaaaccgttgcggaagaaacaccgcatttaatttttaccgaagagattgatcct
gccacaggacttttacctttccaggccaggaaaattgcctttaatctaggtcttagtgga
acagcttttaaagaaatgacaaaatttgtcacctctctttatactgcattcgataaatct
gattcctctttattcgagattaacccggtacttaaaacaagtgacgacaagattttagca
gtagatgctaaagttactttagatgacaatgcacttttccgtcacaaagactacgcagag
atgcgtgataagcgtgaagaaaaccctactgaagtagaagcaaaggaagtaggtcttaac
tatgtggatctagacggtaacgtaggttgtatggttaatggtgctggtcttgctatggca
accatggatcttattaaacaagctggtggtgagcctgcaaacttccttgatgtaggaggt
actgcagatgctaaacgtgtagaagaagcttttagattaattttaaaagatgaaaaagta
gaagccattcttgtgaatatttttggaggtatcgtacgttgtgaccgtgtggcacaaggt
attgtagatgcttataaaaatatgggagatgcaattaaggttcctattattgtaagatta
caaggtaccaatgccgatgtcgcgaagaaactgatcgacgaaagtggtctggcagtttcc
agtgccgtacaatttaaagaagcagcagataaagtacaggctgtgctttcttaa

DBGET integrated database retrieval system