KEGG   Zunongwangia profunda: ZPR_1705Help
Entry
ZPR_1705          CDS       T01216                                 

Definition
zinc-type alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zpr  Zunongwangia profunda
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ZPR_1705
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_1705
  Lipid metabolism
   00071 Fatty acid degradation
    ZPR_1705
  Amino acid metabolism
   00350 Tyrosine metabolism
    ZPR_1705
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZPR_1705
   00626 Naphthalene degradation
    ZPR_1705
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZPR_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1838053..1839057)
Genome map
AA seq 334 aa AA seqDB search
MMKAVQVKEKGGEFEYVDVDKPSPKENEVLIKIEACGICHSDAITKEGVMPIEYPRIPGH
EVVGIIEKVGERVTQWKEGQRVGVGWHGGHCFECEPCRRGDFINCQNAKISGISYDGGYA
EFMTAPQEAIASIPDELSSAEAAPLLCAGITVFNALRNSGIKPGNVVAIQGIGGLGHLAI
QYAAKMGMRTVAISTSDDKKSLASNLGAHHFINAKEQDTVDELQKLGGASLILATAPNSK
AISSVVDGLGPNGKLLVVGATGDPLSVSPFQLIMGKNAVAGWASGTAMDSEDTLKFSALS
GTKPMIEEYPLTDVKKAYQKMMDNEARFRVVLKP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcagtacaagtaaaagaaaaaggtggtgaatttgaatatgttgatgtcgac
aagccttcaccaaaggaaaacgaagttttaattaaaattgaagcctgcggtatttgtcat
agcgatgccattaccaaagaaggtgtgatgcccatcgaatatccaagaataccgggacac
gaagttgtaggtatcatagaaaaggtgggagaacgtgttacacaatggaaagaaggacaa
cgtgtaggtgttggttggcatggtggtcattgttttgaatgcgaaccctgtcgacgtggt
gattttatcaattgccagaatgcaaaaattagtggtatttcttatgatggcggctatgcc
gaatttatgacggcaccccaggaagcgattgccagtattccggatgaattatcttcagcc
gaagctgctcctttactttgtgccgggattacagtctttaatgccttacgaaattctgga
attaaacccggtaatgtagtggctatccagggaattggtggtttggggcatttagccatt
caatatgctgcaaaaatgggaatgcgtaccgttgctatttccaccagcgacgataaaaaa
tccttagcatcaaacctcggggcgcatcattttataaatgcaaaagaacaggataccgta
gatgaattacaaaaattaggtggcgcatctttaattctggcaacagcacctaatagtaaa
gcaattagtagtgtggttgatggactgggaccaaatggtaaacttcttgttgttggtgct
acgggagatccgctatcggtttctccatttcaattaatcatggggaaaaatgccgttgca
ggttgggctagcggaacagctatggatagtgaagatactttaaaatttagcgctttaagt
ggcacgaaaccaatgatcgaagaatatccacttactgatgttaagaaagcttatcagaaa
atgatggataatgaagctcgatttagagtggttttaaaaccatag

DBGET integrated database retrieval system