KEGG   Zunongwangia profunda: ZPR_1838Help
Entry
ZPR_1838          CDS       T01216                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
zpr  Zunongwangia profunda
Pathway
zpr00010  Glycolysis / Gluconeogenesis
zpr00620  Pyruvate metabolism
zpr00640  Propanoate metabolism
zpr00680  Methane metabolism
zpr01100  Metabolic pathways
zpr01110  Biosynthesis of secondary metabolites
zpr01120  Microbial metabolism in diverse environments
zpr01130  Biosynthesis of antibiotics
zpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZPR_1838
   00620 Pyruvate metabolism
    ZPR_1838
   00640 Propanoate metabolism
    ZPR_1838
  Energy metabolism
   00680 Methane metabolism
    ZPR_1838
Enzymes [BR:zpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ZPR_1838
Lipid biosynthesis proteins [BR:zpr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ZPR_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF2270
Motif
Other DBs
NCBI-ProteinID: ADF52168
UniProt: D5B983
Position
1975735..1977642
Genome map
AA seq 635 aa AA seqDB search
MSNYHIKNLEEYFQVYRKSVREPENFWAEIAEEHFTWRKKWDNVLSWDFTKPEVKWFENA
KLNITENCIDRHLLTRGEKTAIIWEPNDSSEEAQHITYNELHKKVNKLANVLKSKGIQKG
DRVCIYLPMVPELAYSVLACARIGAIHSVVFAGFSSKALATRTLDADCKMMITSDGSYRG
AKTLNLKNIVDEALEDCPDVSSVLVVKRTGEEINMKDGRDEWLSPLMDKASEQCAPEIVD
AEDPLFILYTSGSTGKPKGMLHTTAGYMVYTAFTFKNIFNYTEGDVYWCTADIGWITGHS
YIVYGPLANGATTVMFEGVPSYPDYGRFWEIVEKHKITQFYTAPTAIRALAKRNIEFVEN
HDLSSLKVLGSVGEPINEEAWHWFNDNIGKNQSPIVDTWWQTETGGIMISPMPYVTPTKP
TYATLPMPGIQPSLMDDDGKEIKGNQVSGRLSVKFPWPSIARTVWGDHERYKDTYFSTFE
GKYFTGDGAMRDEVGYYRITGRTDDVIIVSGHNLGTAPIEDAINEHPAVAESAVVGFPHD
VKGNALYAFVILKESGESRKRDNLRKEINQQIADKVGPIAKPDKIQFVEGLPKTRSGKIM
RRILRKIASDDTSDLGDTSTLLNPEVVEAIIAEAL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattaccacattaaaaatctggaagaatattttcaggtttatagaaaatccgtg
cgcgaaccagaaaatttttgggcagaaattgccgaagagcattttacctggagaaaaaaa
tgggacaatgtattaagctgggattttaccaaaccagaagtaaaatggtttgaaaatgct
aaactgaatatcactgaaaactgtatagatcgtcatcttttaactcgaggagagaaaacc
gccattatttgggagcctaacgatagtagtgaagaagctcaacatatcacttataacgag
ctgcataaaaaagtaaataagctcgcaaacgttttaaaaagcaagggtattcaaaaagga
gatagggtttgtatctatttaccaatggtgccagaacttgcttattccgttctcgcttgt
gccaggataggggctatacattctgttgtatttgcaggattctccagcaaggcattggct
acaagaactctggatgccgattgtaaaatgatgattacttcagacggttcttatcgtggt
gcaaaaacacttaatcttaagaatattgtagacgaagctttagaagattgtccagatgta
tcctcggttttggtggtaaaaagaactggtgaagaaattaatatgaaagacgggcgcgac
gaatggttgtcccctttaatggataaggcttcagaacaatgcgctcctgaaattgtggat
gctgaagatcctttatttattttatatacctctggttctaccggcaaaccaaaaggaatg
ttacatactaccgcaggatatatggtgtataccgcgtttaccttcaaaaatatttttaat
tataccgaaggtgatgtgtattggtgtacagctgatattggatggatcacggggcattcc
tatatagtttatggtccactggccaacggagctactacagtaatgtttgaaggagtaccg
tcttatcctgattatgggcgtttttgggaaattgtagaaaaacacaaaatcacacaattc
tataccgcaccaactgcgattagagctttggcaaaacgtaatattgaatttgtagaaaat
catgatctttcttctttaaaagttctggggtctgtaggggaacctataaatgaggaggca
tggcattggtttaatgataatataggtaaaaaccagagtcctatagtggatacctggtgg
caaactgaaacaggaggaattatgatttcaccaatgccctatgtaactcccacaaaacct
acttacgcgactttacccatgcctggaattcaacctagcttaatggacgatgatggcaag
gaaataaagggaaatcaggtaagtggtcgcttatctgtaaaatttccctggccatcgatt
gccagaactgtttggggagatcacgagcgctataaggatacttatttttcgacttttgaa
ggaaagtactttaccggtgatggagccatgagggatgaagtgggatattacagaataacc
ggtagaacggatgatgttattattgtttccggacataatctaggtactgcccctatagag
gatgcgattaacgaacatccggcagttgccgaaagtgcagtggttggttttcctcatgat
gtgaaaggaaatgcactgtatgcatttgtaatccttaaggagtctggtgagagccgtaaa
cgtgataacttaagaaaagagatcaatcaacaaattgctgataaagttggaccaattgcc
aagccagataaaatacagtttgtagaaggcttacctaaaacccgaagtggaaaaattatg
cgaagaattttacgtaaaatagcttccgatgatacttcagatttaggagatacttcaacc
ttattaaatcctgaggtggtcgaagcgattattgcagaagctttataa

DBGET integrated database retrieval system