KEGG   Zunongwangia profunda: ZPR_1906Help
Entry
ZPR_1906          CDS       T01216                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
zpr  Zunongwangia profunda
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ZPR_1906
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ZPR_1906
Enzymes [BR:zpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ZPR_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2045463..2046392
Genome map
AA seq 309 aa AA seqDB search
MNELSVNHLLGIKYLQKSDIDLIFNTADHFKEVINRPIKKVPSLRDITIANLFFENSTRT
RLSFELAEKRLSADTINFSAASSSVKKGETLIDTVNNILSMKVDMVVMRHPNPGAGIFLS
KHVKASIVNAGDGAHEHPTQALLDSYSIRERLGEVAGKNVVIVGDILHSRVALSNIFALK
LLGANVKVCGPKTLIPKYIDSLGVEVETNLIKALEWCDVANMLRVQNERMDISYFPSTRE
YTQQFGLNKKILNSLNKEIIVMHPGPINRGVEITSDVADSDQAIILDQVQNGVAVRMAVI
YLLASKIKQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaattaagtgttaaccacttacttgggattaagtacctgcaaaaatcggatatt
gacttaatttttaatactgccgatcattttaaagaagttattaaccggcctattaaaaaa
gtcccatcgttacgagatataaccatagccaacttattttttgaaaatagtaccagaacc
cgcctttcttttgagcttgccgaaaaacgtttaagtgctgatacgattaatttttcagct
gcttcttcctcggttaaaaaaggagaaacgcttattgataccgtaaataatatcttatcg
atgaaagtcgatatggtggttatgagacatcctaatcctggagcaggaatttttctttct
aaacacgtaaaagctagcattgtaaacgcaggggatggagcacatgagcaccccacacaa
gccttgctggattcgtattctatacgtgaacgtttaggagaggttgccggaaagaatgtg
gtgattgtaggagatattttgcatagtcgagtagccctttctaatatttttgccttaaaa
ttactgggagcaaacgtaaaagtttgcggacctaaaacgctaattccaaaatatattgat
tctttgggagtagaggtggaaaccaatcttataaaagcattagaatggtgcgatgttgcc
aacatgctgagggttcaaaatgaaaggatggatattagttatttcccttctaccagagaa
tacacgcaacaatttggtttaaataagaaaatactgaatagtctaaacaaagaaatcatt
gtaatgcacccgggaccgattaatcgcggcgtagaaattaccagtgatgttgcagacagt
gatcaggcaattattttggatcaggtacagaatggtgttgcggtaaggatggcggttata
tatttattggcttctaaaatcaagcaatag

DBGET integrated database retrieval system