KEGG   Zunongwangia profunda: ZPR_1965Help
Entry
ZPR_1965          CDS       T01216                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
zpr  Zunongwangia profunda
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zpr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:zpr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:zpr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2109530..2110645
Genome map
AA seq 371 aa AA seqDB search
MENLKKIIALSVISVTMSCGKTSEEKQNNTTEVTEKEPLNIIFMVGDGMGIPQVSSAFYF
GEHTPNFKQFESIGLSRTSSTSHLITDSAAGATAFSTGEKTYKRAIGVSSDTIALPTILE
QLKEKGYQTGLISLTSITHATPAAYYAHVEDRDMHEEIAKQLVEAEVDFFAGGGKKYFQN
REDGLHLYDSLKAKNYKLDTLELSKPDTARRNAYLLAEEGLPSKTEGRGDFLAEAAINGF
NYFEANKKPFFMMIEGSYIDWGGHAKDDEMMIQEVLDFDKTIGVVLDFVKKHPNTLLVVT
ADHETGGVSIGKAYDESGKEIPQQVQVYFNTDQHSTELVPVFAKGQGEELFRGIYENNEI
YHKLMQAINEN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttaaaaaagattatcgcattatctgtaatttcagtaacaatgagctgcgga
aaaacttccgaagaaaagcaaaataatacaactgaagttaccgaaaaagaaccgctgaat
atcatctttatggttggggacgggatgggaattccgcaagtttccagtgctttttatttt
ggtgaacatacgcccaattttaagcaatttgaaagtataggtcttagccgtacttctagt
accagtcatttaattacagattctgccgccggagctacggctttttctaccggagagaaa
acctataaaagagcaatcggagtttcctcagatacgattgcgctgccaaccattttagag
caattaaaagaaaaaggctatcaaacaggactaattagtttaacctctattacccatgcc
actcccgctgcttattatgcgcatgtagaagatcgcgatatgcacgaagaaattgcaaaa
caactggtagaagctgaggttgacttttttgccggtggtggtaaaaagtattttcaaaat
agggaagatgggctacatctttacgatagcttaaaggcgaaaaattataaattagatact
ttagaattaagtaaaccagacactgcacgtcgtaatgcatatttattagcagaggaaggt
ttgccctctaaaaccgaaggtcgtggagattttcttgctgaagctgccataaatggattt
aattattttgaagccaataagaaaccattttttatgatgattgaaggttcttatattgat
tggggtggtcacgccaaagatgatgagatgatgattcaggaagttctggatttcgataaa
accattggtgtggtcctcgattttgtaaaaaaacacccaaacacattgttggtcgttact
gcagatcatgaaaccggaggtgttagcattggtaaagcctatgacgaaagtgggaaagaa
attccgcagcaggtacaggtatattttaataccgatcagcatagtacagagctggttcct
gtttttgcaaaaggtcagggcgaagaattgtttagaggcatttacgaaaacaacgaaatt
tatcacaaattaatgcaggctatcaatgaaaattaa

DBGET integrated database retrieval system