KEGG   Zunongwangia profunda: ZPR_2101Help
Entry
ZPR_2101          CDS       T01216                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
zpr  Zunongwangia profunda
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ZPR_2101
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZPR_2101
Enzymes [BR:zpr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ZPR_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2256542..2257105
Genome map
AA seq 187 aa AA seqDB search
MEVLETNINGCFEINPKLIYDSRGYFYESFNAARFREKTGLNIQFVQDNQSFSERGVLRG
LHLQKGIHAQAKLVSVLKGKVLDVAIDLRKDSETFGEVYRTLLSEENKKQLFIPRGCAHG
FVVLSETCLFFYKCDNYYHKASEAGIIYDDEDLGIDWQLAKDELIISDKDLVLPSFKDYI
SEYAQVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacttgaaacaaatataaatggttgttttgagatcaacccaaagttgatttat
gatagtcgtggttatttctatgaaagttttaatgcagccaggtttcgggaaaaaacagga
ttaaatattcagtttgtgcaggataaccagtctttttcagaaagaggggttttaagaggg
cttcatcttcagaaggggattcatgcccaggctaaattggtttctgttttaaaaggtaag
gtattggatgtagctatagaccttcgaaaagacagtgagacatttggagaagtttacaga
acgctactttccgaagaaaataaaaaacaactctttatccccaggggttgcgctcatgga
tttgtagttttaagtgaaacatgtctgtttttttataaatgtgataattattatcataaa
gcttcagaagcaggaattatctacgacgatgaagaccttgggatagactggcaattggcg
aaagatgaattgataatttcagataaagatttggttttgccgagttttaaagactatatt
tccgaatacgctcaagtaaaatga

DBGET integrated database retrieval system