KEGG   Zunongwangia profunda: ZPR_2266Help
Entry
ZPR_2266          CDS       T01216                                 

Definition
magnesium chelatase subunit Chll
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
zpr  Zunongwangia profunda
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZPR_2266
Enzymes [BR:zpr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ZPR_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2422389..2423852
Genome map
AA seq 487 aa AA seqDB search
MNMEKVKTLGELKSSGYKSKNIKDELRDNLIAKIKKKEASFTGIHGYDDTVIPELERAIL
SKHNINLLGLRGQAKTRLARLMLNLLDEYIPAVKGSEISDDPLNPISRYAKELIAEKGDQ
TPIIWIHRSERFFEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANRSI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRLPLDMQFVFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPETIEIAKTITQQEAKLDSRQTDMVYVPELAKDLLEQIGFEARESEFI
DEKSGISARMSITAYENLLSTAERRTLKNGEDKTLLRFGDFMGVIPSVTGKVELVYEGEQ
EGAAAVATQLLGDAVKTLFPNYFPKIEKLQRPDEKTPYDDLIEWFFEQTGFELPDDLTDE
EYKKRLDEVGPLNELIKKYQPEMEKTDTYFLKEFLLWGLVEFKKLSKQRYTKGIQFNDLY
GSYISGL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggagaaagtaaaaaccctgggagaactcaaatcttcaggatataaaagtaaa
aacatcaaagatgagcttcgtgataatttaattgcaaaaattaaaaagaaagaagcttca
ttcaccggaattcatgggtacgacgatactgtcattcccgagttagaacgtgcgatatta
tctaaacataacattaatttattaggattacgcgggcaggctaaaacaagattagcgcgt
ttaatgctcaatcttttggacgaatacatcccggcggttaaaggttcagaaattagtgac
gatcctttaaaccctatttcgcgatatgccaaagaactcatcgcagaaaaaggagaccaa
acacctattatctggatccacaggagtgagcgattttttgaaaagttggccaccccagat
gttacggtagccgatttaattggcgatgtagatccgattaaagcagccaatttaaaattg
agttatgcagatgatcgtgtgattcattttggaatgataccacgtgctaatcgtagtatt
tttgtaattaacgagctacccgatttacaggccagaattcaggtggcattgttcaatatt
cttcaggagggcgatatccagattcgcggctttaagttaaggctgcctttagatatgcaa
tttgtatttactgcaaaccctgaagattataccaatcgcggtagtattgtaacaccactt
aaagacaggattggctcgcagattttaacacactatcctgaaactatagagatcgccaag
accattactcagcaagaagctaagttagattccagacaaaccgatatggtttatgtgcca
gaactggcgaaagacctgctggagcaaattggttttgaagctcgagagagtgaatttata
gatgagaagagcggaattagtgccagaatgagtatcacagcgtacgaaaatcttttgagt
acggcagagcgcagaactttaaaaaatggggaagataaaacattgttgcgattcggtgat
tttatgggcgtaattccttcagtaaccggtaaagtagaattggtttacgaaggggagcag
gaaggagctgccgccgtggcgacacaattacttggagatgcggtaaaaaccttattccct
aattatttccctaagatagaaaaattgcaacgaccagatgagaaaacaccatatgatgac
ctgatagaatggttttttgaacaaaccggctttgagctgccagatgatcttacggatgaa
gaatataagaaaaggctagatgaggtaggcccgttaaatgaattgatcaaaaaatatcag
ccagaaatggagaagaccgatacatattttctaaaggaatttttgctttggggattagtg
gaatttaaaaaactaagcaagcaacgatatacaaaagggattcagtttaatgatctctat
ggaagttatattagcggattgtaa

DBGET integrated database retrieval system