KEGG   Zunongwangia profunda: ZPR_2269Help
Entry
ZPR_2269          CDS       T01216                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zpr  Zunongwangia profunda
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZPR_2269
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZPR_2269
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ZPR_2269
Enzymes [BR:zpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ZPR_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2427576..2428883
Genome map
AA seq 435 aa AA seqDB search
MKYFSLNNRTHSSSFENAVIRGLAPDKGLYFPEHIQKLPDSFFAALPNMSQTEVAYHAIK
QFVGDEIPEKDLKEIIATTLDFEFPVVHVKDNVYTLELFHGPTLAFKDVGARFMAGSLGY
FITKNEVGKVTVLVATSGDTGGAVANGFLGVEGIDVVILYPKGKVSKIQEKQLTTLGENV
TALEIDGAFDQCQDMVKQAFLDEEIQSKRQLTSANSINVARWLPQMFYYFLAYRQLASEG
KDIVFSVPSGNFGNICAGMVAKELGLSIKHFIASNNANRTVTDYLETGNYEPKPSVSTIS
NAMDIGNPSNFVRILELFQNEYGNVKENLTSFSYNDEETKQAMQSVYKETGYVMDPHGAV
GYLGLQEHFKTHPDEVGAFLETAHPCKFRETVQEAIGKEIEIPDAIKEVLKKEKKAISIK
DYADLKSFLLSEQGI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttagtctgaataatcgaactcattcttctagtttcgagaatgccgtaatt
agaggtcttgctccagataaaggattatattttccagaacatatccaaaaattaccagat
tctttttttgcggcactgcctaatatgtcacaaactgaagtcgcttatcatgcaattaaa
caatttgtaggcgatgaaattccagaaaaggacctaaaagaaattatcgctacaacttta
gattttgaatttccggtagtacatgtgaaggacaatgtatatactttagaactttttcat
ggccctactttagcctttaaagatgtaggcgctcgttttatggcaggtagtttaggatat
tttatcaccaaaaacgaggtaggaaaagtaacggtacttgttgcaacttcgggagatacc
ggtggagcagttgccaatggatttttaggagtagaaggtattgatgtagtcatcctgtat
cctaaaggtaaagtgagtaaaattcaggagaaacaattaaccacccttggtgaaaatgtt
acggctttagaaattgatggtgctttcgaccagtgtcaggatatggtaaaacaggccttt
ctagatgaagaaattcaatccaagcgacagttaacttccgcaaactcgataaatgtagca
cgttggcttccgcagatgttctattattttttagcttatcggcagttagcttccgaaggg
aaagatattgtgttttctgtgccgagtggtaatttcgggaatatttgtgcggggatggtt
gctaaagaattaggactttccataaagcactttattgcttctaataatgcaaacagaaca
gtaaccgattatttggaaaccggaaattacgagccaaaaccaagtgtttcaaccatttcg
aatgcgatggatattgggaatcccagcaattttgtaagaattttggaactttttcaaaac
gagtatggaaatgtaaaagaaaaccttaccagttttagttacaatgacgaggaaactaaa
caagccatgcaatcggtttataaagaaacgggatatgttatggatcctcatggagcggta
gggtatcttggtctgcaagagcattttaagacacatccagatgaagtaggtgctttttta
gagacggcgcatccctgtaaatttagagaaactgttcaggaagcgattggtaaagaaatc
gaaattccggatgctataaaagaagttttaaagaaagaaaagaaagcaatttcgattaag
gattatgctgatttaaaatcctttctgttaagtgaacaggggatttaa

DBGET integrated database retrieval system