KEGG   Zunongwangia profunda: ZPR_2280Help
Entry
ZPR_2280          CDS       T01216                                 

Definition
two-component system sensor histidine kinase/methyl-esterase/transferase hybrid
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
zpr  Zunongwangia profunda
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:zpr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:zpr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2441666..2445322
Genome map
AA seq 1218 aa AA seqDB search
MTRNNKLTPKEKTRKHENAQSRIIAVGASAGGLEALKAFFTGIPEEDNNTYVVIQHLSPD
YKSMMGELLAKSTKFPIKQIKEGMQMEEKTIYLIPPKCNLLVEDGCLKLVEKPERAHLNL
PIDMFLESLSSYKKEKAIAVILSGTGSDGTRGIRAIKDRDGMVMVQDPEQAKFDGMPKSA
IQTGLVDYILPVEEMGEELRKFINAPMVFDIENHDVEFDQKTLSKILHLIDEKTGLDFRE
YKYSTLARRLARRVNVGGCSSLEEYYDMLVHNDDEIPMLYREFLIGVTNFFRDQRVWEII
ADDIIPELIESKKDNDILKIWDVACSTGEEAYSLAMLLHEEMQRQDKMLEIKIFATDISQ
EHLDIGSAGIYSESVVANVEDKFLKKFFIKKPEGYQIVEKIRRMVIFSKHNIIKNPPFSN
MDMVLCRNLLIYFQSTIQKKTMDVLHYALKEYGFLVLGTSETITSHRDSFEDISRKWKIF
RNVHPRARIRTKNLRPTAGRINDHDEKHHKPRNSDNRTYNSSKQKFVNELNEAIMEQFGA
ASVYVDSEFNIMEAVGEFRKYANLPVSGFTTNLIEMLNKDLKHVVQSTTKKSAKEKKRVV
YHDAIVKEANGVVMKLDIVVKPFKPKNLDNESNFVLTFIEKEVKEEDTIEVEQITISGRT
QEYIVELEEELKKTKEELQTSLEEIETSNEELQAANEELLASNEELQSTNEELQSVNEEI
NTVNAENIQKMDDLAQLNADMNNLLESTNIGTIFLDSDLRIRKFTPAIKKHFSLINSDIG
RPIDNFTTNFGVNRGKGLVDRCNKVMETGKILERNILSKEGRNYLQRISPFRNGEDNTEG
IVITFVDIESLQKAKNKLLASERRFKSFYEEDPVLHFSVDPKTSEIVQCNQEAVEKLEYD
SKEDIIGKPIFELYEDESKLKALRLNKLFQEKGELKNVEQEMVTKNGKIVPVIMNSTVEL
DENGNGITNRFTCVDISELKQVQEELESQKKDLERANHDLEQFVSICSHDLQEPLSTIKF
GSDILGKIYSDKLDQKGKDYIQYIDEASDRLSAQIKALLEHSRIGRNTKKKMVDTRELVE
VVRYDLTKRIKDTNAKVHIGSLPKLMVYEVEMRLLFQNLLSNALKYCAKDKTPEVRISAY
QEDEYWVFSVMDNGIGISEEDQKNIFTIFNRVPTEEKYEGTGVGLAHVHKIVILHGGSIW
VDSQPGVGSTFYFKIKAK
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaacaataaactaacaccaaaggagaaaactagaaaacatgaaaatgcacaa
tccaggattattgctgtgggggcaagtgctggaggtttggaagctttaaaagcatttttt
actggtattcctgaagaagataataatacttatgtggtgattcaacacctttctccagat
tataaaagtatgatgggagaattgttggcaaaatcaaccaaatttcctatcaaacagatt
aaggagggaatgcaaatggaagaaaaaaccatttatcttattccgcctaaatgcaatctt
ctggtagaagatggctgcctaaagcttgttgagaaaccagagcgggcacatcttaattta
cctatagatatgtttttagagtccctttccagttacaagaaggaaaaagcaattgcagta
atactaagcggaactggtagtgatggtactcgcggcataagagccataaaggatagagac
ggtatggtgatggttcaggatcctgaacaggccaagtttgatggaatgccaaaaagcgct
atccagaccggtttggtagactatattttacccgttgaggaaatgggggaggaactgcgt
aaatttattaatgcaccaatggtttttgatatcgaaaaccacgatgtggaattcgaccag
aaaacgctatctaaaatccttcatcttattgatgaaaaaacaggtcttgattttagggag
tataaatattctactttagcccgccgactggcaagaagggtaaacgtaggaggctgtagt
agtttggaagaatattacgacatgctggtacacaatgatgatgaaatccctatgctgtat
cgggagtttttaattggggtaactaatttttttagagatcaaagagtttgggaaattatc
gcagatgatattatcccagaacttatagagtctaaaaaagataatgatattcttaaaatt
tgggatgtagcttgtagtacgggagaagaagcgtattctctggccatgttactgcatgag
gaaatgcaacgacaggataagatgctcgaaataaaaatttttgctacagatatttcacaa
gagcatttggatataggtagtgctggtatctattctgaaagtgtggtcgctaacgtagaa
gataaatttctgaagaagttttttatcaaaaaaccggaaggctaccagattgtagagaaa
attaggcgtatggtcattttctctaaacataatattattaaaaatccgccttttagtaat
atggatatggtattatgccgtaatcttcttatctattttcaatctactatccagaagaaa
accatggacgttttacattacgcccttaaagaatatggctttttggtattaggaaccagt
gaaaccataacctcgcacagggattcttttgaagatattagcagaaaatggaaaatcttt
agaaacgtacatccaagagctagaatcagaaccaaaaatttaagacctacagccggcagg
atcaatgatcatgatgaaaaacatcataagcctagaaatagcgataatcgcacctataat
agcagtaagcaaaagtttgtaaatgagcttaacgaggctattatggagcagtttggtgct
gcaagtgtatatgtagattcagaatttaatatcatggaagcagttggtgaatttagaaag
tacgctaaccttcctgtctctggattcactactaatttaatagaaatgcttaataaagat
cttaagcatgtagtgcaatcgaccaccaaaaaatcggcaaaggaaaagaaaagggtagtt
tatcatgacgctattgttaaagaagctaatggagtcgtgatgaaattagatattgtagtt
aagccttttaagccgaaaaacctggataatgaaagtaattttgtacttacttttattgaa
aaagaagtaaaggaagaagatactatagaggttgaacagataacaataagtggtagaact
caggaatatatagtcgagcttgaagaggaactgaaaaaaaccaaagaagaactgcaaact
tctttggaagagatcgaaaccagcaatgaagaactgcaggcagctaatgaagaactcctg
gcttctaatgaagaattacaaagtaccaatgaagaactgcaaagcgtcaacgaagaaatc
aatacggtaaatgccgagaatatccagaagatggatgatttggcacaacttaatgccgat
atgaataatcttctggaaagtacaaatattggtacgatctttttggatagtgacctgaga
atccgaaaatttactccagctattaaaaagcattttagtttaataaatagtgatattggt
cgacctatcgataatttcacaactaattttggagtaaatagagggaaaggtctggtagat
cgctgcaataaagtgatggaaaccggtaaaattttagagcgcaatattctttctaaagaa
ggaagaaattacttacagcgaatttctccttttagaaatggagaagataatacggaaggt
attgtaattacctttgtggatatcgaatccctgcagaaggcaaaaaataaattgttggcc
agtgaacgtcgttttaaatctttttatgaagaggacccggtattgcattttagtgtagat
ccaaaaacttcagaaattgtacagtgtaaccaggaagcggtagaaaaattggaatatgat
tctaaagaggatattatagggaaaccgatattcgaactttacgaagatgaatctaaacta
aaagctttacgacttaataagttattccaggaaaaaggggagcttaaaaatgtagagcag
gagatggtgaccaaaaatggaaaaattgttccggtaatcatgaactctaccgtagagctt
gatgaaaatggtaatggaataaccaacaggtttacctgtgtcgatatttcagaattgaaa
caggtacaggaagaattagaaagccaaaaaaaggatctggaaagagcgaatcatgattta
gaacagtttgtttctatttgttctcatgaccttcaggaacctttaagtaccattaagttt
ggtagtgatatcctgggtaaaatttattcagataagttagatcaaaaaggcaaagactat
atccagtatatcgatgaagcttcagatcgattatcagctcagataaaagcgctgttagag
cattccagaattggtagaaataccaagaagaaaatggtggatacgcgcgagcttgtagaa
gttgtaagatacgaccttaccaagcgaataaaagataccaatgcaaaagtgcatattgga
agtctgcctaaattaatggtctatgaagtcgaaatgcgacttttatttcaaaacctttta
agtaatgccttaaaatactgtgcaaaagataagactcctgaagttcggatctctgcttat
caggaagatgaatactgggtgttttctgtaatggataacggtataggaatttcagaggaa
gatcagaaaaatatatttaccatttttaaccgggtaccaacagaagaaaagtatgaagga
accggtgttgggttggcgcatgtgcataagattgtgatcttacatggcggttctatttgg
gtagattcgcaaccaggagtgggcagtactttctattttaaaatcaaggcaaagtaa

DBGET integrated database retrieval system