KEGG   Zunongwangia profunda: ZPR_2387Help
Entry
ZPR_2387          CDS       T01216                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
zpr  Zunongwangia profunda
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZPR_2387
  Amino acid metabolism
   00340 Histidine metabolism
    ZPR_2387
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ZPR_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2562051..2563334
Genome map
AA seq 427 aa AA seqDB search
MNKIYNPSQSEWEVVLKRPTKTVDDIEDTVNQIFAEVKAKGDTAVAKYTDMFDGIKLENT
LVTSEEIATAEAEISEELKSAILLAKKNIEKFHAAQKTTKVEIETTSGVKCWQEKRPIQK
IGLYIPGGSAPLFSTILMLAVPAAIAGCKEIVLCTPPNKEGKVHPAILYTANLCGVTKIN
KIGGIQAIAALTFGTETVPKVYKIFGPGNQFVTVAKQLATRHNVSIDMPAGPSELLVVAD
DSANPAYVASDLLSQAEHGADSQVILVSTSKTFLDAVEVEVENQLSALPRKAIAEKAIEN
SKLIYVENDEIALDLINEYGPEHFIISTENNDFYTEGIINAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFMKSMTFQQISEEGIKSIGPAIELMAEAEGLQAHKNAVT
LRLKDLN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatatataatccttcacaatcagaatgggaggttgttttaaaacggccaacc
aaaaccgtagatgatattgaagatacggtaaaccaaatttttgccgaagtaaaagccaaa
ggagacaccgcggtggcaaaatataccgatatgtttgatggtattaagcttgaaaatact
ttagtaacatcagaagaaattgcaactgctgaggctgaaatatcagaagaattaaaatca
gccattcttttagctaaaaagaatattgaaaaattccatgctgctcaaaaaacaacgaaa
gttgaaatagaaacaacaagcggtgtaaaatgctggcaggaaaagagacccattcagaaa
atcggattatatattcccggaggaagcgcacccttattttcgacaatcttaatgttagca
gtaccagcggcaattgcaggttgtaaagaaatcgtgctttgtacgcctcctaacaaagaa
gggaaagttcatcctgcaattttatacacggctaatttatgcggagtcactaaaatcaat
aagattggagggattcaggcgattgctgcattaactttcggaaccgagacagtccccaag
gtatataaaatttttggccccggaaatcaatttgtaaccgtagccaagcagttagctact
cgtcataatgtctctatcgatatgccagcgggtccttcagaattactggtagtggcagac
gattcggctaatccggcttatgtagcatcagatttactgagtcaggctgaacatggtgcc
gatagtcaggtaattttagtatctacttcaaaaacattcttggatgcagtagaagtagaa
gtagaaaatcagttgtcagcattgccaagaaaagccattgcagaaaaggcaatcgaaaat
tcgaaattgatctatgtagagaacgatgagatcgccctggatttaatcaatgaatacggc
ccggagcattttatcatttctacggaaaataacgatttttatacggaaggtattatcaat
gcaggttcggtattcattggtaattatacacctgaaagtgccggagattacgcttcagga
actaatcatacgttaccgactaatggttatgccaaacaatatagtggtgtaaatctggat
agttttatgaagagtatgacgtttcagcaaatttcagaagaaggaataaaaagtataggc
cctgctatcgaattgatggctgaagcagaaggcttacaagcgcataaaaatgcagtgacc
ctgcgattgaaagatttgaattaa

DBGET integrated database retrieval system